BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30852 (495 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g24860.1 68416.m03118 hydroxyproline-rich glycoprotein family... 29 1.3 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 29 2.3 At3g03950.2 68416.m00414 expressed protein contains Pfam profile... 28 3.0 At3g03950.1 68416.m00413 expressed protein contains Pfam profile... 28 3.0 At2g28830.1 68415.m03505 armadillo/beta-catenin repeat family pr... 28 3.0 At5g03890.1 68418.m00365 hypothetical protein 27 5.3 At1g12970.1 68414.m01506 leucine-rich repeat family protein 27 5.3 At3g05430.1 68416.m00595 PWWP domain-containing protein contains... 27 6.9 At5g62270.1 68418.m07818 expressed protein 27 9.2 At3g04610.1 68416.m00493 KH domain-containing protein similar pu... 27 9.2 At1g52325.1 68414.m05906 hypothetical protein 27 9.2 At1g17130.1 68414.m02087 cell cycle control protein-related cont... 27 9.2 >At3g24860.1 68416.m03118 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 310 Score = 29.5 bits (63), Expect = 1.3 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +3 Query: 96 LAVPHHSSRAPGS*GPKGAW--PHRELPASSPQPSNEGTS*P 215 +A P +S P P A PH++ P S PQP+N + P Sbjct: 1 MATPSPTSSPPSDSNPNSAATPPHQKQPPSPPQPTNPSSPPP 42 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 28.7 bits (61), Expect = 2.3 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = +1 Query: 46 PNGYQDPKHPEEEVVSNWPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 210 P+ P+ P+E N PY +P+ K RR P P + P+P PP Sbjct: 463 PSPVHKPQPPKESPQPNDPYDQSPV-----KFRRSPPPPPVHSPPPPSPIHSPPP 512 >At3g03950.2 68416.m00414 expressed protein contains Pfam profile PF04146: YT521-B-like family Length = 424 Score = 28.3 bits (60), Expect = 3.0 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = +1 Query: 235 MKQKVAESVLQRVVGEEAPKVLHKQFNSPINLYSEQNIANSIR 363 MKQ V+ LQR GE P+ K I YSE ++ N I+ Sbjct: 217 MKQDVSAVDLQRYNGENFPESFVKAKFFVIKSYSEDDVHNCIK 259 >At3g03950.1 68416.m00413 expressed protein contains Pfam profile PF04146: YT521-B-like family Length = 425 Score = 28.3 bits (60), Expect = 3.0 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = +1 Query: 235 MKQKVAESVLQRVVGEEAPKVLHKQFNSPINLYSEQNIANSIR 363 MKQ V+ LQR GE P+ K I YSE ++ N I+ Sbjct: 218 MKQDVSAVDLQRYNGENFPESFVKAKFFVIKSYSEDDVHNCIK 260 >At2g28830.1 68415.m03505 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 654 Score = 28.3 bits (60), Expect = 3.0 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 248 WQSRCCSEWLAKRHLRCCTSNSTLQS-IYTRNRTLQTL 358 ++ C +WL HL C + TL S I T N L++L Sbjct: 281 YERECIKKWLEGGHLTCPKTQETLTSDIMTPNYVLRSL 318 >At5g03890.1 68418.m00365 hypothetical protein Length = 179 Score = 27.5 bits (58), Expect = 5.3 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -1 Query: 327 IDWRVELLVQHLRCLFANHSLQHRLCHLL 241 +++R + V H+ F+ HS+ H HLL Sbjct: 22 LEYREPISVHHILTQFSGHSISHNNTHLL 50 >At1g12970.1 68414.m01506 leucine-rich repeat family protein Length = 464 Score = 27.5 bits (58), Expect = 5.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 157 PTESYLRHHPNPAMRAPPN 213 P SY+ HH +PA APP+ Sbjct: 9 PLLSYVLHHSDPASHAPPS 27 >At3g05430.1 68416.m00595 PWWP domain-containing protein contains Pfam profile:PF00855 PWWP domain Length = 965 Score = 27.1 bits (57), Expect = 6.9 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +2 Query: 320 QSIYTRNRTLQTLSGSKLRLCQLTAITDGRTLSRGKSFTKNAPMQQST 463 +S+Y +T + L+ + LR+ ++ TL KS+TK ++ ST Sbjct: 327 RSVYCLMKTHEPLNRAPLRVPLSGSLVSAETLGNPKSYTKAMNVKDST 374 >At5g62270.1 68418.m07818 expressed protein Length = 383 Score = 26.6 bits (56), Expect = 9.2 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = +3 Query: 78 RRSCQQLAVPHHSSRAPGS*GPKGAWPHRELPASSPQPSNE 200 RRS + + A G G G W LP S +P NE Sbjct: 326 RRSSEGWKITVEKLGAKGKRGAGGGWKFMSLPDGSSRPLNE 366 >At3g04610.1 68416.m00493 KH domain-containing protein similar putative nucleic acid binding protein GB:CAB39665 [Arabidopsis thaliana]; Pfam HMM hit: KH domain family of RNA binding proteins Length = 577 Score = 26.6 bits (56), Expect = 9.2 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 5/54 (9%) Frame = +1 Query: 178 HHPNPAMRAPPNHD--YRDTLMKQKVAESVLQRVV---GEEAPKVLHKQFNSPI 324 H+P P M+ PP HD Y M+Q E + + G E P +H P+ Sbjct: 400 HNPPPYMQPPPRHDSYYPPPEMRQPPMEKQPHQGISAYGREPPMNVHVSSAPPM 453 >At1g52325.1 68414.m05906 hypothetical protein Length = 145 Score = 26.6 bits (56), Expect = 9.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +2 Query: 290 LRCCTSNSTLQSIYTRNRTLQTLSGSKLRLCQLTAI 397 L CCT T +S Y + T +L K QL+ + Sbjct: 31 LECCTEEKTYRSFYVEDSTSSSLIFLKTLFLQLSEL 66 >At1g17130.1 68414.m02087 cell cycle control protein-related contains similarity to Swiss-Prot:Q9P7C5 cell cycle control protein cwf16 [Schizosaccharomyces pombe] Length = 331 Score = 26.6 bits (56), Expect = 9.2 Identities = 9/37 (24%), Positives = 24/37 (64%) Frame = +1 Query: 58 QDPKHPEEEVVSNWPYRTTPLVLPGAKVRREPGPTES 168 ++PK P+++ +S P+++ + + ++++P PT S Sbjct: 264 ENPKEPKKQAISKQPFKSVHIKV----IKKQPQPTSS 296 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,653,954 Number of Sequences: 28952 Number of extensions: 262845 Number of successful extensions: 828 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 827 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 868578304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -