BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30850 (726 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 28 0.34 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 4.2 DQ437578-1|ABD96048.1| 234|Anopheles gambiae short neuropeptide... 23 9.6 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 27.9 bits (59), Expect = 0.34 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 6/59 (10%) Frame = +1 Query: 532 GSWKTPSKQKKNFNLPQP------KMANTDLTRLLKSDEIRKVLRAPNKRVIRATRKLN 690 G K P K+KK +LP+P K N DL ++LK L+ +V + R N Sbjct: 153 GQSKQPKKKKKKRSLPKPEAVVIEKCENIDLAKVLKGLTHDDALKDVGDQVAKVRRTQN 211 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 24.2 bits (50), Expect = 4.2 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -2 Query: 533 PNKGSSLPNAD*VQMTKRPR*PPGA 459 P G P V M RP+ PPGA Sbjct: 212 PRPGGMYPQPPGVPMPMRPQMPPGA 236 >DQ437578-1|ABD96048.1| 234|Anopheles gambiae short neuropeptide F prepropeptide protein. Length = 234 Score = 23.0 bits (47), Expect = 9.6 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 10/63 (15%) Frame = +1 Query: 508 FGRLDPLFGSWKTPSKQKKNFNLPQPKM------ANT--DLTRLLKSDEI--RKVLRAPN 657 FGR DPL+ S+ + ++NF P +N +L + D++ +K +RAP Sbjct: 101 FGRNDPLWTSFNENALLEENFEKRAPSQRLRWGRSNLFGNLVNQFQQDDVMQQKTIRAPQ 160 Query: 658 KRV 666 R+ Sbjct: 161 LRL 163 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 727,746 Number of Sequences: 2352 Number of extensions: 14299 Number of successful extensions: 39 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -