BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30845 (756 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 24 1.1 AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory recept... 24 1.5 AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory recept... 24 1.5 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 2.6 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 8.0 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 24.2 bits (50), Expect = 1.1 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 62 PADFYHVHHHQNHI 21 P D HVHHHQ + Sbjct: 128 PTDNSHVHHHQTSL 141 >AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory receptor candidate 56 protein. Length = 358 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 380 WFDEIVVTRKREEISNLLKSLMNKYNP 460 W D V RK +EIS L KS++ +P Sbjct: 231 WTDVSNVKRKSKEISKLPKSMLAISDP 257 >AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory receptor candidate 21 protein. Length = 386 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 380 WFDEIVVTRKREEISNLLKSLMNKYNP 460 W D V RK +EIS L KS++ +P Sbjct: 231 WTDVSNVKRKSKEISKLPKSMLAISDP 257 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 506 GKLIESEDNEECLEGERGNQNSIKKSEK 589 GKL E N+E +G+ G I+K +K Sbjct: 129 GKLSSFESNDETKDGKVGLYERIQKLKK 156 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +2 Query: 383 FDEIVVTRKREEISNLLKSLMNKYNPDSHL 472 F ++ +T K ++ + ++KY P HL Sbjct: 129 FAKVKLTNKSNGNGQIMLNSLHKYKPTVHL 158 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,067 Number of Sequences: 336 Number of extensions: 3348 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -