BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30845 (756 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 3.1 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 23 4.1 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 22 7.1 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 56 DFYHVHHHQNHIAYLSH 6 D +HVHH NH A L H Sbjct: 277 DNHHVHH-ANHHAILGH 292 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 22.6 bits (46), Expect = 4.1 Identities = 9/42 (21%), Positives = 23/42 (54%) Frame = -1 Query: 720 LFSISLAILIVFRTIVPSEGSPKLRFTNSLGICLTNVNVAVS 595 L S+++ ++ + ++ P+E +P + + ICL A++ Sbjct: 252 LLSMTVFLMTIRESLPPTEKTPLISLYYGVSICLVTFASALA 293 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/51 (21%), Positives = 22/51 (43%) Frame = +2 Query: 284 FTDCGLYLLQYVEQFFKDPITDYTLPIKQLTNWFDEIVVTRKREEISNLLK 436 F+ G Y L + +KD Y K+ W ++ R++I +++ Sbjct: 68 FSCIGYYKLNKIHDAYKDLNQRYGALCKEEALWNFPMISVFSRQDIETIIR 118 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,459 Number of Sequences: 438 Number of extensions: 4008 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -