BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30838 (686 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6LF19 Cluster: Putative uncharacterized protein; n=1; ... 33 6.5 >UniRef50_Q6LF19 Cluster: Putative uncharacterized protein; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 337 Score = 33.1 bits (72), Expect = 6.5 Identities = 22/75 (29%), Positives = 35/75 (46%) Frame = +2 Query: 209 VKFTFYLFLFFKSNFIRFL*SHYPFVFNYHSLFLSETILLQSLQNSVKREPADIQDVFIQ 388 +KF LF FF S ++ ++Y F+ N H+ F S L S+ + + + Sbjct: 202 IKFHSLLFAFFSSYYLGLQIANYYFINNIHN-FFSSFFFLTSISSIYLADYYIWASYYFL 260 Query: 389 SQFIRIFLLFAQFNL 433 S IFLLF +N+ Sbjct: 261 SFNYFIFLLFNYYNM 275 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 529,449,128 Number of Sequences: 1657284 Number of extensions: 9452494 Number of successful extensions: 18722 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 18210 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18716 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 53719013270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -