BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30838 (686 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24606| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_2588| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_9249| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_24606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 200 FWRVLELFI-ISNYIFNFVVNSEIACGNINLSVST 99 F R+L+ F IS+Y N V+N + G N+ ST Sbjct: 270 FTRILDFFPHISSYFINSVINEKHQSGKTNIEAST 304 >SB_2588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1068 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/68 (22%), Positives = 30/68 (44%) Frame = +2 Query: 242 KSNFIRFL*SHYPFVFNYHSLFLSETILLQSLQNSVKREPADIQDVFIQSQFIRIFLLFA 421 K IRF +VF + + + + + ++ P + +++Q+ F + L Sbjct: 892 KMRSIRFYVRTLLYVFKWMYDSMPPFLRVVTCSSTADCYPPALTMLYLQTAFYAVAALVN 951 Query: 422 QFNLPECW 445 F +PECW Sbjct: 952 AFRIPECW 959 >SB_9249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 549 KRLHSESLTVPIALSYESSISLINAIPIQYWAYP*TAYTIKITNE 683 KR + S P++ SSI +I A+ +Q + T Y +KI + Sbjct: 78 KRAAAPSEATPVSKGCRSSIEVIEAVEVQKYLPGITEYRVKIAKK 122 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,486,453 Number of Sequences: 59808 Number of extensions: 295635 Number of successful extensions: 500 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 437 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 500 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -