BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30837 (800 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6L418 Cluster: Putative uncharacterized protein; n=1; ... 34 4.8 UniRef50_Q0IDH7 Cluster: Putative uncharacterized protein; n=1; ... 33 6.3 >UniRef50_Q6L418 Cluster: Putative uncharacterized protein; n=1; Solanum demissum|Rep: Putative uncharacterized protein - Solanum demissum (Wild potato) Length = 674 Score = 33.9 bits (74), Expect = 4.8 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +2 Query: 635 KRNFHHLTIDKLIWRFPCVPRKIVFFFKTFSSYIKYIEPRG 757 K+ ++LT DK++W + P V + TF S+I + RG Sbjct: 324 KKYLNNLTADKIVWNYHWFPSAEVIYMSTFRSFIVLMGLRG 364 >UniRef50_Q0IDH7 Cluster: Putative uncharacterized protein; n=1; Synechococcus sp. CC9311|Rep: Putative uncharacterized protein - Synechococcus sp. (strain CC9311) Length = 299 Score = 33.5 bits (73), Expect = 6.3 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +1 Query: 442 KEVVTLFWCLKALRRVRRSHALLPAEPSTCPGLPLGLLEVAIE 570 +EVV L WCL A R + A+L EP G+ +GL ++++ Sbjct: 113 QEVVLLVWCLNAQLRSSKGSAVLLPEPVRELGVKIGLRNLSVQ 155 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 617,496,242 Number of Sequences: 1657284 Number of extensions: 10764643 Number of successful extensions: 21640 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21634 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 68731504465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -