BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30837 (800 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0048 + 7796372-7796674,7796969-7797169 30 2.5 03_01_0068 - 546475-546615,546709-546819,547449-547482,547582-54... 29 3.3 >05_03_0048 + 7796372-7796674,7796969-7797169 Length = 167 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 3/27 (11%) Frame = -1 Query: 551 RPSGNPGQVEGS---AGSKACERLTRR 480 RPSG+P V GS AG +AC TRR Sbjct: 36 RPSGDPAHVPGSELRAGQRACAGTTRR 62 >03_01_0068 - 546475-546615,546709-546819,547449-547482,547582-547673, 547904-548062,548178-548251,548477-548551,548820-548903, 548981-549110 Length = 299 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -2 Query: 757 PSGFYIFYIRTKGFKKKNNFSWYTWKSPNQFIYR*VVE 644 P+G Y F + + +N+ W K+ NQ+I+R +VE Sbjct: 95 PAGMYTFRMEMPVVEVRNHGLWLLAKNVNQYIHRVLVE 132 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,784,028 Number of Sequences: 37544 Number of extensions: 268491 Number of successful extensions: 598 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 592 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 598 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2174172540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -