BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30836 (695 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_11360| Best HMM Match : PDZ (HMM E-Value=0) 40 0.002 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_20776| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.055 SB_15888| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.055 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 34 0.096 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.096 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 34 0.13 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 34 0.13 SB_42214| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 34 0.13 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 34 0.13 SB_36313| Best HMM Match : Crl (HMM E-Value=5.1) 33 0.17 SB_20851| Best HMM Match : Cbl_N3 (HMM E-Value=0) 33 0.17 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_39346| Best HMM Match : Drf_FH1 (HMM E-Value=0.027) 33 0.22 SB_33702| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_8845| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.2) 33 0.22 SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_33602| Best HMM Match : Amelogenin (HMM E-Value=0.83) 33 0.29 SB_3036| Best HMM Match : Metallothionein (HMM E-Value=0.81) 33 0.29 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_8332| Best HMM Match : PDZ (HMM E-Value=1.3e-17) 32 0.39 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_20015| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_10994| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_53291| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 31 0.67 SB_28622| Best HMM Match : CcmD (HMM E-Value=0.55) 31 0.67 SB_23069| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_19556| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 31 0.67 SB_32715| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_8336| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.84) 31 0.89 SB_6877| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_57323| Best HMM Match : ShTK (HMM E-Value=0) 31 0.89 SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_56567| Best HMM Match : PDZ (HMM E-Value=5.6e-20) 31 1.2 SB_47804| Best HMM Match : E-MAP-115 (HMM E-Value=1.4) 31 1.2 SB_43489| Best HMM Match : BB1 (HMM E-Value=3.8) 31 1.2 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_49341| Best HMM Match : Rad21_Rec8_N (HMM E-Value=2.3) 31 1.2 SB_33596| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_17101| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) 30 1.6 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_20828| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_5589| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8) 30 1.6 SB_57156| Best HMM Match : DUF1456 (HMM E-Value=4.9) 30 2.1 SB_44668| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-05) 30 2.1 SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_26911| Best HMM Match : Trypsin (HMM E-Value=0) 30 2.1 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 30 2.1 SB_39767| Best HMM Match : CBAH (HMM E-Value=0.86) 30 2.1 SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_1657| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 29 2.7 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_47005| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_42387| Best HMM Match : CH (HMM E-Value=2.7) 29 2.7 SB_36926| Best HMM Match : Flocculin (HMM E-Value=0.93) 29 2.7 SB_23868| Best HMM Match : Gal_Lectin (HMM E-Value=1.4e-05) 29 2.7 SB_15424| Best HMM Match : PAN (HMM E-Value=0.00016) 29 2.7 SB_54886| Best HMM Match : SH3_2 (HMM E-Value=3.2e-24) 29 2.7 SB_39621| Best HMM Match : Extensin_2 (HMM E-Value=0.078) 29 2.7 SB_39566| Best HMM Match : Pyocin_S (HMM E-Value=3.3) 29 2.7 SB_32226| Best HMM Match : PID (HMM E-Value=3.9e-30) 29 2.7 SB_24292| Best HMM Match : LTXXQ (HMM E-Value=1.7) 29 2.7 SB_23539| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_57005| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_56900| Best HMM Match : I-set (HMM E-Value=8e-10) 29 3.6 SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_45934| Best HMM Match : Gp-FAR-1 (HMM E-Value=2) 29 3.6 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 29 3.6 SB_20163| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_208| Best HMM Match : zf-C2H2 (HMM E-Value=1.7) 29 3.6 SB_58610| Best HMM Match : RVT_1 (HMM E-Value=0.061) 29 3.6 SB_43553| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.29) 29 3.6 SB_40783| Best HMM Match : MH2 (HMM E-Value=0) 29 3.6 SB_24167| Best HMM Match : FF (HMM E-Value=9.2) 29 3.6 SB_18429| Best HMM Match : FF (HMM E-Value=9.2) 29 3.6 SB_12700| Best HMM Match : POPLD (HMM E-Value=1.9) 29 3.6 SB_10727| Best HMM Match : Drf_FH1 (HMM E-Value=3.8) 29 3.6 SB_10217| Best HMM Match : ubiquitin (HMM E-Value=1.6e-06) 29 3.6 SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) 25 4.0 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_53945| Best HMM Match : POPLD (HMM E-Value=1) 29 4.8 SB_32383| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_23088| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_20236| Best HMM Match : Pec_lyase_N (HMM E-Value=6.6) 29 4.8 SB_56225| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_37150| Best HMM Match : 7tm_1 (HMM E-Value=0.011) 29 4.8 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 29 4.8 SB_26558| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_22331| Best HMM Match : fn3 (HMM E-Value=7.1e-14) 29 4.8 SB_8646| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-27) 29 4.8 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 29 4.8 SB_41879| Best HMM Match : DUF1658 (HMM E-Value=7) 28 6.3 SB_40933| Best HMM Match : DUF548 (HMM E-Value=1.7) 28 6.3 SB_34181| Best HMM Match : Extensin_2 (HMM E-Value=0.57) 28 6.3 SB_29692| Best HMM Match : ig (HMM E-Value=5.4e-12) 28 6.3 SB_24489| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_21211| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 28 6.3 SB_54131| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_42720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_37603| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) 28 6.3 SB_35674| Best HMM Match : SH2 (HMM E-Value=0) 28 6.3 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 28 6.3 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 28 6.3 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_52290| Best HMM Match : PDZ (HMM E-Value=8.6e-18) 28 8.3 SB_35964| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_19708| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_15319| Best HMM Match : Transposase_9 (HMM E-Value=3.2) 28 8.3 SB_1728| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 8.3 SB_47719| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_45708| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_40460| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_37987| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 28 8.3 SB_29502| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 28 8.3 SB_25200| Best HMM Match : RVT_1 (HMM E-Value=1.7) 28 8.3 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 28 8.3 SB_1163| Best HMM Match : DMA (HMM E-Value=1.4e-11) 28 8.3 SB_1049| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = +1 Query: 316 PLAP-RSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDG 462 PL P +P+P S+TP++ P LPP+ S + PV PS +QPQ G Sbjct: 903 PLQPYNTPMPPISSTPYQAPPTLPPTTLTTPSWSQPVPV-PSMYQPQPPG 951 >SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1069 Score = 39.9 bits (89), Expect = 0.002 Identities = 33/112 (29%), Positives = 43/112 (38%), Gaps = 6/112 (5%) Frame = +1 Query: 286 EREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGE 465 + E G T P++P P A + +P P + PE STP P QP + Sbjct: 235 QHETKPGETTVSTPKAPGPTQPAGTTKNTAPQPETQ--PEGTTASTPEVPGPTQPTQTKK 292 Query: 466 YRTYLLSPSSTRTDETIDESIQSQPYRTT------PLVLPGAKVRREPGPTE 603 T +S T T +QP TT P PGA + PG TE Sbjct: 293 TTTKPVSQPGETTASTPKAPGPTQPASTTIEATPQPETQPGASTAKAPGSTE 344 Score = 30.3 bits (65), Expect = 1.6 Identities = 27/103 (26%), Positives = 39/103 (37%), Gaps = 1/103 (0%) Frame = +1 Query: 319 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSP-SS 495 + P+ P AS P P P + + P T P Q + SP SS Sbjct: 62 IKPKPKNPAASNAPKEGNKPFPATGSPGSASPPKTNGPDVGTQQPSPASPTSIKQSPNSS 121 Query: 496 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHP 624 + T +T E S P +++ LP + PT+S L P Sbjct: 122 SSTGQTPTEKTDSTP-KSSGSTLPTSSTPATQNPTDSSLSTKP 163 >SB_11360| Best HMM Match : PDZ (HMM E-Value=0) Length = 625 Score = 39.9 bits (89), Expect = 0.002 Identities = 30/113 (26%), Positives = 47/113 (41%), Gaps = 6/113 (5%) Frame = +1 Query: 127 KVTPGTPAGRD--LVRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVEREGL 300 K+ G A +D L GD I ++ + D+ HEDA + K ++ +V+ R Sbjct: 49 KIIEGGAAQQDGRLQVGDKIISVNLQNLEDVSHEDAVQVLKATKERVTIVVSRLTAYYSE 108 Query: 301 RGSGTPLAP----RSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQ 447 + P P ++P P PSP P +P +PVPP+ Q Sbjct: 109 QTDSAPSPPTLPKQTPPPPTPEVIETAPSPSPGENGEVNHVPPESPVPPASPQ 161 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 157 DLVRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQ 276 +L RGD I ++D D + HE A K A + + + Q Sbjct: 224 ELRRGDQIKAVNDVDLTNATHEQAAAALKGAGSTVTITAQ 263 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 37.5 bits (83), Expect = 0.010 Identities = 31/114 (27%), Positives = 41/114 (35%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS 495 P SPI N S P +P P P P S P P P D +PSS Sbjct: 463 PSISTSPISNPSPRPHPSPHPSSNPSPNPSPNPSSDPSPNPSSNPSSDPS-----PNPSS 517 Query: 496 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHD 657 + E I + T+P+ P P P+ S P+P + P+ D Sbjct: 518 NPSSEPSPNPISNPSISTSPISNPHPSSNPSPHPS-SNPSSEPSPNPSSNPSSD 570 Score = 35.5 bits (78), Expect = 0.041 Identities = 28/119 (23%), Positives = 44/119 (36%), Gaps = 5/119 (4%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS 495 P +P P+ S+ P PSP P S + P + P F P + SP+ Sbjct: 541 PHPSSNPSPHPSSNPSSEPSPNPSSNPSSDPSPNPSSDPSLSFSPS-SSSSPSVRPSPNL 599 Query: 496 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHH-----PNPAMRAPPNHD 657 S ++ + P P P+ S R+H PNP++ P+H+ Sbjct: 600 ISNPNRNSNSNSNRNPNPSSNPSPSLSPNPSPNPSTSPYRNHSSNTNPNPSLGPNPSHN 658 Score = 33.1 bits (72), Expect = 0.22 Identities = 31/114 (27%), Positives = 46/114 (40%), Gaps = 8/114 (7%) Frame = +1 Query: 334 PIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTY-LLSPSSTRTDE 510 P PN S+ P PSP P S + P S P P S P + +PSS + + Sbjct: 511 PSPNPSSNPSSEPSPNPISNPSISTSPISNPHPSSNPSPHPSSNPSSEPSPNPSSNPSSD 570 Query: 511 -----TIDESIQSQP-YRTTPLVLPGAKVRREPG-PTESYLRHHPNPAMRAPPN 651 + D S+ P ++P V P + P + S +PNP+ P+ Sbjct: 571 PSPNPSSDPSLSFSPSSSSSPSVRPSPNLISNPNRNSNSNSNRNPNPSSNPSPS 624 Score = 30.7 bits (66), Expect = 1.2 Identities = 34/114 (29%), Positives = 46/114 (40%), Gaps = 4/114 (3%) Frame = +1 Query: 322 APRS-PIPNASATPFRTPSPLPPS--WRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPS 492 +PR P P+ S+ P PSP P S P S P S P P P + SP+ Sbjct: 474 SPRPHPSPHPSSNPSPNPSPNPSSDPSPNPSSNPSSDPSPNPSSNPSSEP-------SPN 526 Query: 493 STRTDETIDESIQSQPY-RTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPN 651 ++ +I S S P+ + P P + EP P S NP+ PN Sbjct: 527 PI-SNPSISTSPISNPHPSSNPSPHPSSNPSSEPSPNPS-----SNPSSDPSPN 574 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPV 429 +P P PN S+ P PSP P S P S P P+ Sbjct: 492 SPNPSSDPSPNPSSNPSSDPSPNPSS--NPSSEPSPNPI 528 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 +P +P PN S P PSP P S + P + P S+ P Sbjct: 480 SPHPSSNPSPNPSPNPSSDPSPNPSSNPSSDPSPNPSSNPSSEPSP 525 >SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2749 Score = 37.5 bits (83), Expect = 0.010 Identities = 37/172 (21%), Positives = 68/172 (39%), Gaps = 11/172 (6%) Frame = +1 Query: 124 RKVTPGTPAGRD--LVRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVI-------Q 276 R V P A +D + +GD + ++ + L H++ NL +N P ++ LV+ + Sbjct: 2535 RHVVPLGVAAKDGRIRKGDRVLSVNGRSTKGLTHQEVLNLLQNLPRRVVLVVSRSNFPRK 2594 Query: 277 RDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESL--PRSTPVPPSQFQP 450 R + L + + P + A P + SP + P + P +P + + Sbjct: 2595 RSLSLSSLNILHNKSSEKEPTTESGAWPTKMESPKKKNLMSPSDVNPPSLEKIPLTLERE 2654 Query: 451 QLDGEYRTYLLSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTES 606 D Y + S + E +Q P P V ++ E GP++S Sbjct: 2655 NTDSTYDRFKKRLFSGGNGKAFKEILQKTP--PEPSV---KEITLEKGPSDS 2701 Score = 36.7 bits (81), Expect = 0.018 Identities = 31/119 (26%), Positives = 47/119 (39%), Gaps = 7/119 (5%) Frame = +1 Query: 124 RKVTPGTPAGR--DLVRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVEREG 297 + + PGTPA + L GD + +++D + H A + KN P +KL + R +RE Sbjct: 2317 KDIQPGTPAEKCGHLRTGDQLLQVNDECLVGVTHAYALEVLKNTPPLVKLTVARKKDREE 2376 Query: 298 LR----GSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQF-QPQLD 459 L G + P+ + P P S P P S F P+ D Sbjct: 2377 LEVDNLGRRRVVDDSKPLFQTAVESSTVPKTATDVTLSPRSARDMRPRPLSSFGTPKTD 2435 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = +1 Query: 124 RKVTPGTPAGRD--LVRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDV 285 R++ PG+ R+ L GD + ++ ++ H A ++ K +++ LVI RDV Sbjct: 222 RRILPGSVCDRNGKLQPGDRLISMNGESLTNVTHSTALHILKKPTDKVVLVILRDV 277 >SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1417 Score = 37.5 bits (83), Expect = 0.010 Identities = 28/96 (29%), Positives = 41/96 (42%), Gaps = 4/96 (4%) Frame = +1 Query: 307 SGTPLAPR---SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTY 477 S TP+ P +PI + +T TP PS + P +TP+ PS + T Sbjct: 1272 STTPIKPSPSTNPIKPSPSTTSTTPIKPSPSTTPIKPSPSTTPIKPSPSTTPIKPSPSTT 1331 Query: 478 LLSPSSTRTDET-IDESIQSQPYRTTPLVLPGAKVR 582 + PS + T T I S + P + +P PG R Sbjct: 1332 PIKPSPSTTSTTPIKPSPSTTPIKPSPSTTPGVHDR 1367 Score = 34.3 bits (75), Expect = 0.096 Identities = 34/125 (27%), Positives = 54/125 (43%) Frame = +1 Query: 307 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLS 486 S TP+ P SP S TP + PSP + S +TP+ PS + T + Sbjct: 1260 STTPIKP-SP-STTSTTPIK-PSPSTNPIKPSPSTTSTTPIKPSPSTTPIKPSPSTTPIK 1316 Query: 487 PSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDYRD 666 PS + T I S + P + +P ++ P P+ + ++ P+P+ P HD D Sbjct: 1317 PSPSTT--PIKPSPSTTPIKPSPSTTSTTPIK--PSPSTTPIK--PSPS-TTPGVHDRGD 1369 Query: 667 TLMKQ 681 + Q Sbjct: 1370 RVQHQ 1374 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 36.3 bits (80), Expect = 0.024 Identities = 29/116 (25%), Positives = 37/116 (31%), Gaps = 3/116 (2%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP---SQFQPQLDGEYRTYLL 483 T +P P P P+ P P PP P P + P PP + P + Y Sbjct: 86 TNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPN 145 Query: 484 SPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPN 651 +P + + P P P P P Y PNP PPN Sbjct: 146 APYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPY-PPPPNPPYPPPPN 200 Score = 29.9 bits (64), Expect = 2.1 Identities = 21/80 (26%), Positives = 27/80 (33%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS 495 PL P P P P+ P P PP P P + P PP P Y P++ Sbjct: 159 PLYPPPPNPPPPNAPY-PPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNA 217 Query: 496 TRTDETIDESIQSQPYRTTP 555 + + PY P Sbjct: 218 PNPPYPPPPNAPNPPYPPPP 237 >SB_20776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 35.1 bits (77), Expect = 0.055 Identities = 31/139 (22%), Positives = 56/139 (40%) Frame = +1 Query: 238 FKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPR 417 +KN N+ + R+ G+R S T + R+P P P GPE +P Sbjct: 23 YKNPGNKNGIRHPREENSHGIRNSHTRI--RNPKPYWKTCHGAIRGIQQPDCTGPEMIPG 80 Query: 418 STPVPPSQFQPQLDGEYRTYLLSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGP 597 +P + P+ SP+ T +ES +S P + P ++PG ++ + P Sbjct: 81 PETIPGPETIPKS---------SPTDPGTRNDTEESPKSTPRKCGPEMIPGPEMIPKSTP 131 Query: 598 TESYLRHHPNPAMRAPPNH 654 + R + ++ P + Sbjct: 132 NDPRTRTDTEESPKSTPRN 150 >SB_15888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2437 Score = 35.1 bits (77), Expect = 0.055 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Frame = +1 Query: 124 RKVTPGTPA--GRDLVRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRD 282 +K+ PG PA L GDII +++ + H+DA N+ + ++L+I+RD Sbjct: 1393 KKMFPGQPATLSGKLQVGDIIQEVNGKSLANASHQDAINIIRQESPAVQLLIKRD 1447 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +1 Query: 139 GTPAGRD--LVRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQR 279 G PA D L +GD I ++DD D +++H A N+ + ++L + R Sbjct: 1705 GDPAKSDGRLQKGDQILQVDDVDISEMKHMAAVNVLRATKKHVRLEVLR 1753 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 34.3 bits (75), Expect = 0.096 Identities = 33/114 (28%), Positives = 42/114 (36%), Gaps = 1/114 (0%) Frame = +1 Query: 313 TPLAPRS-PIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSP 489 TP AP S PIP A TP +PLPP S +PP+ P + P Sbjct: 190 TPPAPPSPPIPTAPPTPPMPETPLPPG---------SPHIPPAPLHPH---------IPP 231 Query: 490 SSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPN 651 + + I P P P + P S PNP++ APPN Sbjct: 232 APPNPSKAIATPNPPMPETPLPPATPNPFI-PPASPNPSIPPAPPNPSIPAPPN 284 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/46 (39%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +1 Query: 316 PLAPRSP-IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 P AP +P IP A P P+P PS P P PP+ F P Sbjct: 315 PPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPPNLFIP 360 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 280 DVEREGLRGSGTP-LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL 456 D+ E G+ P + + P+ + T T P PP+ P ++P + P PP+ P + Sbjct: 144 DISVEDCTGTPEPTITSKPPVTETTTTKPETKPPKPPA---PSTIP-TPPTPPAPPSPPI 199 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 34.3 bits (75), Expect = 0.096 Identities = 26/59 (44%), Positives = 28/59 (47%), Gaps = 4/59 (6%) Frame = +1 Query: 286 EREGLRGSGTPLAP-RSPIPNASATPF---RTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 +R+ S PL P R P P SA P R PSP PPS P P P PPS QP Sbjct: 1030 KRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSP-PPSEPAP---PPRQPPPPSTSQP 1084 Score = 30.3 bits (65), Expect = 1.6 Identities = 28/107 (26%), Positives = 42/107 (39%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS 495 P P P P TP+P P SW ES P PP +P+ +++T + + + Sbjct: 1095 PTNPAHPTEPPPRQPKPTPAPRPRSW--VESQP-ELHRPPPPIKPKPCQKFKTAVHATKN 1151 Query: 496 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAM 636 E +SQ Y + P + PG + P R PA+ Sbjct: 1152 C-------EEPESQQYSSMPDLNPGKAQGDDEAPVAPARRRRIPPAI 1191 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 33.9 bits (74), Expect = 0.13 Identities = 34/125 (27%), Positives = 49/125 (39%), Gaps = 11/125 (8%) Frame = +1 Query: 307 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPE-SLPRSTPVPPSQFQPQL-DGEYRTYL 480 + T AP P P + P P P PP R P + P PP+ +P +G + Sbjct: 351 TSTRSAPPPP-PGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKPSFTNGPVSNNI 409 Query: 481 LSPSST---RTD-ETIDESIQSQPYRTTPLVLPGAKV----RREPGPTESYL-RHHPNPA 633 + ++ R + T++E +PY+ TP P R P P S P P Sbjct: 410 MDSKNSFECRFNFRTLNELPPPEPYQDTPKTYPSKNQQKANRGNPRPASSSRGAPPPVPP 469 Query: 634 MRAPP 648 R PP Sbjct: 470 SRGPP 474 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +1 Query: 334 PIPNASATPFRTPS-PLPPSWRGPESLPRSTPVPPSQFQP 450 P P S P T S P PP R P+ L P PP + P Sbjct: 342 PPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPP 381 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 33.9 bits (74), Expect = 0.13 Identities = 34/125 (27%), Positives = 49/125 (39%), Gaps = 11/125 (8%) Frame = +1 Query: 307 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPE-SLPRSTPVPPSQFQPQL-DGEYRTYL 480 + T AP P P + P P P PP R P + P PP+ +P +G + Sbjct: 263 TSTRSAPPPP-PGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKPSFTNGPVSNNI 321 Query: 481 LSPSST---RTD-ETIDESIQSQPYRTTPLVLPGAKV----RREPGPTESYL-RHHPNPA 633 + ++ R + T++E +PY+ TP P R P P S P P Sbjct: 322 MDSKNSFECRFNFRTLNELPPPEPYQDTPKTYPSKNQQKANRGNPRPASSSRGAPPPVPP 381 Query: 634 MRAPP 648 R PP Sbjct: 382 SRGPP 386 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +1 Query: 334 PIPNASATPFRTPS-PLPPSWRGPESLPRSTPVPPSQFQP 450 P P S P T S P PP R P+ L P PP + P Sbjct: 254 PPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPP 293 >SB_42214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSP----LPPSWRGPESLPRSTPVPP 435 P P+ N + PF P P +P + GPE +P++TP P Sbjct: 76 PVKPLYNYALVPFHDPGPEMIPVPETISGPEMIPKTTPTDP 116 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 33.9 bits (74), Expect = 0.13 Identities = 23/69 (33%), Positives = 30/69 (43%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS 495 P +P P P S +P R P P PPS P + P P P L YL P++ Sbjct: 212 PPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPPTLGYL--PTA 269 Query: 496 TRTDETIDE 522 T E++ E Sbjct: 270 RLTRESVTE 278 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/40 (42%), Positives = 20/40 (50%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 P+AP + +P A A P SP PPS P P P PP Sbjct: 169 PIAPAATVP-APAVPLAAASPPPPSGGPPPPPPPPPPPPP 207 Score = 31.1 bits (67), Expect = 0.89 Identities = 23/78 (29%), Positives = 28/78 (35%) Frame = +1 Query: 229 QNLFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPES 408 Q AP + ++ + S P P P P A TP + PSP PP P S Sbjct: 79 QTQASTAPPLVPAGVEAPTPTPMVAQSVAPTPP--PPPRAPETPSQAPSPPPP----PTS 132 Query: 409 LPRSTPVPPSQFQPQLDG 462 P PP P G Sbjct: 133 PATRAPPPPPPIAPATGG 150 >SB_36313| Best HMM Match : Crl (HMM E-Value=5.1) Length = 442 Score = 33.5 bits (73), Expect = 0.17 Identities = 18/39 (46%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGP-ESLPRSTP 426 TP P SP AS P RTP PL + P ES P + P Sbjct: 128 TPTTPTSPATPASGPPIRTPIPLKETPTQPLESAPAAMP 166 >SB_20851| Best HMM Match : Cbl_N3 (HMM E-Value=0) Length = 695 Score = 33.5 bits (73), Expect = 0.17 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 4/51 (7%) Frame = +1 Query: 286 EREGLRGSGTPLAPRSPIPNAS--ATPFRTPS--PLPPSWRGPESLPRSTP 426 ER L + TP +P + +AS A+P R+PS P P P + PRS+P Sbjct: 306 ERRMLNSTNTPTSPTLIVTHASPFASPGRSPSNSPRPSPKNSPRTSPRSSP 356 >SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4072 Score = 33.5 bits (73), Expect = 0.17 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 3/70 (4%) Frame = +1 Query: 313 TPLAPRS-PIPNASATPFRTPSPLPPSWRGPE--SLPRSTPVPPSQFQPQLDGEYRTYLL 483 T AP + P+P +A P T PLP + PE +LP++T P + P+ T L Sbjct: 2961 TTAAPETTPLPKTTAAPETT--PLPKTTAAPETTTLPKTTAAPETTTLPKTTAAPETTTL 3018 Query: 484 SPSSTRTDET 513 P +T ET Sbjct: 3019 -PKTTAAPET 3027 Score = 32.3 bits (70), Expect = 0.39 Identities = 29/98 (29%), Positives = 40/98 (40%), Gaps = 3/98 (3%) Frame = +1 Query: 313 TPLAPRSP-IPNASATPFRTPSPLPPSWRGPE--SLPRSTPVPPSQFQPQLDGEYRTYLL 483 T AP + +P +A P T PLP + PE +LP+ T P + P+ T + Sbjct: 2889 TTAAPETTAVPKTTAAPETT--PLPKTTAAPETTTLPKITAAPETTAVPKTTAAPETTSV 2946 Query: 484 SPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGP 597 P +T ET + TTPL A P P Sbjct: 2947 -PKTTAAPETTSVPKTTAAPETTPLPKTTAAPETTPLP 2983 Score = 30.7 bits (66), Expect = 1.2 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Frame = +1 Query: 313 TPLAPRSP-IPNASATPFRTPSPLPPSWRGPES--LPRSTPVPPSQFQPQLDGEYRTYLL 483 T AP + +P +A P T PLP + PE+ LP++T P + P+ T L Sbjct: 2949 TTAAPETTSVPKTTAAPETT--PLPKTTAAPETTPLPKTTAAPETTTLPKTTAAPETTTL 3006 Query: 484 SPSSTRTDET 513 P +T ET Sbjct: 3007 -PKTTAAPET 3015 Score = 30.3 bits (65), Expect = 1.6 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Frame = +1 Query: 313 TPLAPRS-PIPNASATPFRTPSPLPPSWRGPE--SLPRSTPVPPSQFQPQLDGEYRTYLL 483 T AP + P+P +A P T LP + PE +LP++T P + P+ T L Sbjct: 2973 TTAAPETTPLPKTTAAPETT--TLPKTTAAPETTTLPKTTAAPETTTLPKTTAAPETTTL 3030 Query: 484 SPSSTRTDET 513 P +T ET Sbjct: 3031 -PKTTAAPET 3039 >SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1393 Score = 33.5 bits (73), Expect = 0.17 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 4/71 (5%) Frame = +1 Query: 130 VTPGTPAGRD--LVRGDIIAKIDDYDARDLRHEDAQNLFKNAP--NQIKLVIQRDVEREG 297 + GTPA D L RGD I +D D H D +L K+A Q+ L ++R R+ Sbjct: 763 IVDGTPAAADGRLRRGDEILYVDGVSVIDGYHRDVISLMKSAAQNGQVTLGVRR---RQT 819 Query: 298 LRGSGTPLAPR 330 + G TP R Sbjct: 820 MPGRSTPSGVR 830 >SB_39346| Best HMM Match : Drf_FH1 (HMM E-Value=0.027) Length = 345 Score = 33.1 bits (72), Expect = 0.22 Identities = 18/39 (46%), Positives = 20/39 (51%) Frame = +1 Query: 298 LRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLP 414 L +GTP P ATP+R PLPPSWR LP Sbjct: 123 LEATGTP-TPLLEATCTPATPWRQLVPLPPSWRQLVPLP 160 >SB_33702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 479 Score = 33.1 bits (72), Expect = 0.22 Identities = 32/92 (34%), Positives = 41/92 (44%), Gaps = 3/92 (3%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPP--SWRGPE-SLPRSTPVPPSQFQPQLDGEYRTYLLS 486 P P+ A+ P R SPLPP S +G E P S P+PPS P+ LS Sbjct: 173 PQLPKKNGLQANTPPPRPASPLPPKKSEQGSELGRPPSKPLPPS---PRSKSPMPGQSLS 229 Query: 487 PSSTRTDETIDESIQSQPYRTTPLVLPGAKVR 582 R+D T S++ PY P P A +R Sbjct: 230 -LPQRSDSTEGLSVRPAPYSHLP-PCPSAALR 259 >SB_8845| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.2) Length = 490 Score = 33.1 bits (72), Expect = 0.22 Identities = 18/39 (46%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPS-WRGPESLPRSTP 426 TP P SP+ AS P RTP PL + G ES P + P Sbjct: 148 TPTTPTSPVIPASGPPTRTPIPLKETPTPGLESAPAAMP 186 >SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 32.7 bits (71), Expect = 0.29 Identities = 20/45 (44%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +1 Query: 307 SGTPLAPRSP-IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 438 S TP P +P P+A TP +P PS G S P STP PS Sbjct: 494 SSTPSTPSTPSTPSAPGTPGTPSTPSTPSAPGTPSTP-STPSTPS 537 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/44 (43%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 310 GTPLAPRSP-IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 438 GTP P +P P+A TP +P PS S P STP PS Sbjct: 510 GTPGTPSTPSTPSAPGTPSTPSTPSTPSTPSTPSTP-STPSMPS 552 Score = 30.3 bits (65), Expect = 1.6 Identities = 25/87 (28%), Positives = 36/87 (41%), Gaps = 2/87 (2%) Frame = +1 Query: 313 TPLAPRSP-IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSP 489 TP P +P +PN +TP +P P G S P + P + P + L +P Sbjct: 687 TPSTPSTPSMPNTPSTPSTPSTPSTPITPGTPSTPSTPSAPGTPITP-------STLSTP 739 Query: 490 SSTRTDET-IDESIQSQPYRTTPLVLP 567 S+ T T S S P + L +P Sbjct: 740 STPSTPSTRSTPSTPSTPSTPSTLSMP 766 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +1 Query: 313 TPLAPRSP-IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 438 TP P +P P+A +TP +P PS S P STP PS Sbjct: 89 TPSTPSTPSTPSAPSTPSTPSTPSTPSTPSTPSTP-STPSAPS 130 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +1 Query: 313 TPLAPRSP-IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 438 TP P +P P+A +TP +P PS S P STP PS Sbjct: 116 TPSTPSTPSTPSAPSTPSTPSTPSTPSTPSTPSTP-STPSTPS 157 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +1 Query: 313 TPLAPRSP-IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 438 TP P +P P+ +TP +P PS S+P STP PS Sbjct: 224 TPSTPSTPSTPSTLSTPITPSTPSTPSTPSTPSMP-STPSTPS 265 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +1 Query: 313 TPLAPRSP-IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 438 TP P +P P+ +TP +P PS S+P STP PS Sbjct: 774 TPSTPSTPSTPSTLSTPITPSTPSTPSTPSTPSMP-STPSTPS 815 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/43 (41%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +1 Query: 313 TPLAPRSPI-PNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 438 TP P +P PN +TP P PS S P STP PS Sbjct: 266 TPSTPSTPCTPNTPSTPSTPSMPSTPSTPSTPSTP-STPSTPS 307 Score = 29.5 bits (63), Expect = 2.7 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +1 Query: 313 TPLAPRSP-IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 438 TP P +P P+ +TP +P PS S+P STP PS Sbjct: 517 TPSTPSAPGTPSTPSTPSTPSTPSTPSTPSTPSMP-STPSTPS 558 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/43 (41%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +1 Query: 313 TPLAPRSPI-PNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 438 TP P +P PN +TP P PS S P STP PS Sbjct: 816 TPSTPSTPCTPNTPSTPSTPSMPSTPSTPSTPSTP-STPSTPS 857 Score = 27.9 bits (59), Expect = 8.3 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +1 Query: 313 TPLAPRSPI----PNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 438 TP P +P P+A +TP +P PS S P STP PS Sbjct: 53 TPSTPSTPCTHSTPSAPSTPSTPSTPCTPSTPSTPSTP-STPSTPS 97 Score = 27.9 bits (59), Expect = 8.3 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 9/51 (17%) Frame = +1 Query: 313 TPLAPRSPI----PNASATPFRTPSPLPPSWRGPESLP-----RSTPVPPS 438 TP P +PI P+ +TP +P+ PS S P RSTP PS Sbjct: 155 TPSTPSTPITPGTPSTPSTPSAPGTPITPSTLSTPSTPSTPSTRSTPSTPS 205 >SB_33602| Best HMM Match : Amelogenin (HMM E-Value=0.83) Length = 242 Score = 32.7 bits (71), Expect = 0.29 Identities = 19/46 (41%), Positives = 22/46 (47%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 +P APR P A + P +P PPS GP SL P PS P Sbjct: 16 SPTAPRPHRPIAPS-PLGPTTPSPPSHHGPISLRPHRPTIPSPHDP 60 >SB_3036| Best HMM Match : Metallothionein (HMM E-Value=0.81) Length = 597 Score = 32.7 bits (71), Expect = 0.29 Identities = 26/75 (34%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP-PSQFQPQLDGEYRTYLLSPSSTR 501 PRS +AS P T +PLP S S+P +T P P+ F P + + +PSST Sbjct: 4 PRSRTISASFVPSNTFNPLPAS-----SVPSNTFNPLPASFVPSITFSPLSSSSTPSSTF 58 Query: 502 TDETIDESIQSQPYR 546 + TI+ + Q R Sbjct: 59 SPFTIERLLSKQTPR 73 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 32.3 bits (70), Expect = 0.39 Identities = 20/52 (38%), Positives = 22/52 (42%) Frame = +1 Query: 295 GLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 G+RG P P P P P PP +RGP PR P PP Q P Sbjct: 464 GMRGMPPPPMGMYPPPRGFPPP--PFGPPPPFYRGPPP-PRGMPPPPRQRMP 512 >SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 32.3 bits (70), Expect = 0.39 Identities = 16/35 (45%), Positives = 24/35 (68%) Frame = +1 Query: 169 GDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVI 273 GDII KI+D A L+ DA + +N+ +Q++LVI Sbjct: 508 GDIILKINDKKADSLKLRDAIDEVRNSKDQLELVI 542 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/50 (26%), Positives = 26/50 (52%) Frame = +1 Query: 130 VTPGTPAGRDLVRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQR 279 + G+PA L D+I ++++ + H DA K++ +L+I+R Sbjct: 402 IVKGSPADGLLRVNDVICQVNEVNVDKCYHSDAVQALKDSGFSARLIIKR 451 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 32.3 bits (70), Expect = 0.39 Identities = 28/107 (26%), Positives = 40/107 (37%) Frame = +1 Query: 328 RSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTD 507 RS + S+ R+ SP R PE R PP + + + D R SPS Sbjct: 838 RSASGSDSSPHRRSESPRDRRRRSPEHRRRREASPPRRDRKRYDSPPRRRRRSPSPPPRR 897 Query: 508 ETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 648 D S+ R +P P + RR+ R +P+ PP Sbjct: 898 RRRDSYSPSRRRRDSPTPSPPPRRRRKSPSPSPPRRRRRSPSNSPPP 944 >SB_8332| Best HMM Match : PDZ (HMM E-Value=1.3e-17) Length = 1038 Score = 32.3 bits (70), Expect = 0.39 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Frame = +1 Query: 100 DEP-RNFGQRKVTPGTPAGR-DLVR-GDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLV 270 D P +N + P + A + D VR GD + +++ + H DA +F++ P+ IKLV Sbjct: 141 DSPLKNHYVSDILPNSCASKCDCVRIGDELLEVNGHKLSGRTHADALTIFRSLPSVIKLV 200 Query: 271 IQRD 282 + R+ Sbjct: 201 VFRN 204 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 31.9 bits (69), Expect = 0.51 Identities = 29/88 (32%), Positives = 39/88 (44%), Gaps = 5/88 (5%) Frame = +1 Query: 307 SGTPLAPRSPIPN--ASATPFRTPSPLPPSWRG-PESLPR-STPVPPSQFQPQLDGEYRT 474 S PL P P+P AS+ P P P PP+ P S + P+PP + L Sbjct: 679 SKPPLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDE- 737 Query: 475 YLLSPSSTRTDETIDESIQSQPYR-TTP 555 SP S++ T+ S S P R +TP Sbjct: 738 ---SPPSSKHPPTVSPSSSSAPPRPSTP 762 >SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 31.9 bits (69), Expect = 0.51 Identities = 24/79 (30%), Positives = 28/79 (35%), Gaps = 3/79 (3%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP--QLDGEYRTYLLSPSST 498 PR TP T PL P+ R P P+ PP F L R SP T Sbjct: 123 PRQSYALQQTTPLHTSQPLRPTPRRPSDTPQPFTPPPRPFDDLRSLSSTPRKSTTSPQFT 182 Query: 499 R-TDETIDESIQSQPYRTT 552 T T +S S + T Sbjct: 183 PFTHTTTSQSTSSYSLQAT 201 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 31.9 bits (69), Expect = 0.51 Identities = 17/74 (22%), Positives = 33/74 (44%), Gaps = 2/74 (2%) Frame = +1 Query: 220 EDAQNLFKNA--PNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSW 393 +D ++++ P ++K I R V ++ + P ++ N + P+P PP+ Sbjct: 171 DDEDHIYETVDKPRKVKKGIFRRVHKKTKPSAAAPKQQKATPVNPPEPDYLEPTPPPPAA 230 Query: 394 RGPESLPRSTPVPP 435 P P + P PP Sbjct: 231 PAPPPPPAAAPPPP 244 >SB_20015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 31.5 bits (68), Expect = 0.67 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +1 Query: 304 GSGTPLAPRSPIPNASATPFR-TPSPLPPSW 393 G+ +PLAP S P SA P PLPP W Sbjct: 357 GNNSPLAPPSRPPPPSARPLTGNEEPLPPGW 387 >SB_10994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 31.5 bits (68), Expect = 0.67 Identities = 34/121 (28%), Positives = 51/121 (42%), Gaps = 10/121 (8%) Frame = +1 Query: 301 RGSGTPLAP-----RSPIPNASATPFRTP-SPLPPSWRGPESLPRSTPVPPSQ---FQPQ 453 R TP P ++P+P + + R+ +P+PPS R + + TPVPPS+ P Sbjct: 50 RSDRTPAPPSRRSDQTPVPPSWRSDLRSDLTPVPPSRRS-DLISDRTPVPPSRSSDLTPV 108 Query: 454 LDGEYRTYLLSPSSTRTDETIDESIQSQPYRTTPLVLPGAKV-RREPGPTESYLRHHPNP 630 P S R+D T + R+ P +K+ R P P R PNP Sbjct: 109 PPSRRSDLAPVPPSRRSDLTPVPLSRRSDLRSDWTPAPPSKICGRTPSPPS--WRSDPNP 166 Query: 631 A 633 + Sbjct: 167 S 167 >SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4865 Score = 31.5 bits (68), Expect = 0.67 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +1 Query: 268 VIQRDVEREGLRGSGTPLAPRSPIPNAS-ATPFRTPSPLPPSWRGPESLPRSTPV 429 ++ D R + +P S + + +TP R+PSP RG E+ RSTPV Sbjct: 3137 IVDPDTPRSKTKRRPSPGPIESSVKRSEKSTPKRSPSPAAGKQRGDEAKGRSTPV 3191 >SB_53291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 675 Score = 31.5 bits (68), Expect = 0.67 Identities = 34/113 (30%), Positives = 44/113 (38%), Gaps = 6/113 (5%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESLP--RSTPVPPSQFQPQLDGEYRTYLLSPSST 498 P +P P+ +RTP P PP R PE P S+P PP+ P + T LS S Sbjct: 544 PATPTPDHQ---YRTPPP-PP--RSPECQPTLNSSPSPPTGSGPLTGNPHVTTQLSHGSH 597 Query: 499 RTDETIDESIQSQPYRTTPLVLPGAKVRREP----GPTESYLRHHPNPAMRAP 645 E ++P TP P + +P P S P P R P Sbjct: 598 PATECNQTVPPAEPVAETP---PTTQANNDPVSSCMPDASSQAPQPLPEPRRP 647 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 31.5 bits (68), Expect = 0.67 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 349 SATPFRTPSPLPPSWRGPESLPRSTPVPP 435 +ATP TP P PP P +LP +T PP Sbjct: 427 TATPPPTPPPTPPPTPPPTTLPPTTQPPP 455 >SB_28622| Best HMM Match : CcmD (HMM E-Value=0.55) Length = 1087 Score = 31.5 bits (68), Expect = 0.67 Identities = 27/96 (28%), Positives = 41/96 (42%) Frame = +1 Query: 370 PSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETIDESIQSQPYRT 549 P+P PS P+ T PS FQPQ + L+ +TRT I S + P + Sbjct: 217 PAPDLPSSITLTISPQKTATKPSTFQPQSSTRHP---LTSITTRTTP-IKPSPSTTPIKP 272 Query: 550 TPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHD 657 +P P +P P+ + ++ P+ P HD Sbjct: 273 SPSTTP-----IKPSPSTTPIKPSPSTTSTTPGVHD 303 >SB_23069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 378 Score = 31.5 bits (68), Expect = 0.67 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +2 Query: 443 SSHNWTANTEPICCRLLPRAPMRPSMSLFR-VSRTAPLLSCSRE 571 SS NW + IC L P +P P L + +S+ A CS E Sbjct: 82 SSRNWLLGDKQICRSLFPLSPTNPDPQLVQLISQQARSQGCSEE 125 >SB_19556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 31.5 bits (68), Expect = 0.67 Identities = 31/110 (28%), Positives = 40/110 (36%), Gaps = 5/110 (4%) Frame = +1 Query: 340 PNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETID 519 P+A TP P P P E +TP PP F Y P + + T+ Sbjct: 59 PHAPNTPSLPPDPCAPPTLNTEPTRETTPTPPLSFS-------TGYTTRP-APNSPLTLH 110 Query: 520 ESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRA-----PPNH 654 E S+ TPL P +V E+ R P+P A PP H Sbjct: 111 EQFLSK----TPLPPPSLEVSSHEAFQETLHRPPPSPVQEAKASPRPPRH 156 >SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) Length = 524 Score = 31.5 bits (68), Expect = 0.67 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +1 Query: 319 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGE 465 L PR P+ A P R P P P + PE P P P + +P+ + E Sbjct: 245 LPPRQPV--AEPEPERQPEPEPEPEQEPEPEPEPEPEPEPEPEPEPEPE 291 >SB_32715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 31.1 bits (67), Expect = 0.89 Identities = 37/125 (29%), Positives = 52/125 (41%), Gaps = 1/125 (0%) Frame = +1 Query: 241 KNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRS 420 K P Q+ RD + G+ L PR IP+A TP SPL + P S R+ Sbjct: 4 KTIPGQLPSSQDRD-DTLSEEGNQHLLPPR--IPDAIVTPSGAGSPLLQAQATPGS--RN 58 Query: 421 TPVPPSQFQPQLDGEYRTYLLSPSSTRTDETIDE-SIQSQPYRTTPLVLPGAKVRREPGP 597 + PP P D EY + + + ++ DE S S P TP + + RR P Sbjct: 59 SADPPLPHDP--DTEYDSAVTEAYGDKATDSEDEASPVSTP--VTPQLRRSMRDRRPPPR 114 Query: 598 TESYL 612 Y+ Sbjct: 115 LSDYV 119 >SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1199 Score = 31.1 bits (67), Expect = 0.89 Identities = 24/77 (31%), Positives = 32/77 (41%), Gaps = 5/77 (6%) Frame = +1 Query: 433 PSQFQPQLDGEYRTYLLSPSSTRTDETIDES-----IQSQPYRTTPLVLPGAKVRREPGP 597 P Q P G++ + S + +D T D S Q P TTP++ KV EPG Sbjct: 489 PGQLLPPPSGKFAREAIKESDSDSD-TSDSSPPTSPTQQSPLETTPVLPLPEKVTPEPGS 547 Query: 598 TESYLRHHPNPAMRAPP 648 T +P APP Sbjct: 548 TTPPSPPPDSPKSVAPP 564 >SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1351 Score = 31.1 bits (67), Expect = 0.89 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPL-PPSWRGPESLPRSTP 426 TP P SP AS P RTP P+ S ES P + P Sbjct: 254 TPTTPTSPATPASGPPIRTPIPVKETSTTALESAPAAMP 292 >SB_8336| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.84) Length = 509 Score = 31.1 bits (67), Expect = 0.89 Identities = 27/113 (23%), Positives = 41/113 (36%), Gaps = 1/113 (0%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPS 492 TP P + P A+ TP + + PP+ P + P +T P + +P+ Sbjct: 46 TPTTPTTTTPPATTTPTKPTNTTPPATTTP-TKPTTTTPPATTTPTTPTTTTPPATTTPT 104 Query: 493 STRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHP-NPAMRAPP 648 T + ++P TTP PG +P T P P PP Sbjct: 105 KPTTTTPPATTTPTKPTTTTP---PGTTTPTKPTTTTPPATTTPTKPTTTTPP 154 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +1 Query: 304 GSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTP 426 G+ TP P + P A+ TP + + PP+ P +TP Sbjct: 127 GTTTPTKPTTTTPPATTTPTKPTTTTPPATTTPTKPTTTTP 167 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTP 426 TP P + P A+ TP + + PP+ P +TP Sbjct: 144 TPTKPTTTTPPATTTPTKPTTTTPPATTTPTKSTTTTP 181 >SB_6877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 422 Score = 31.1 bits (67), Expect = 0.89 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPL-PPSWRGPESLPRSTP 426 TP P SP A P RTP PL P ES P + P Sbjct: 122 TPTTPTSPATPARGPPIRTPIPLKEPPTPALESAPAAMP 160 >SB_57323| Best HMM Match : ShTK (HMM E-Value=0) Length = 911 Score = 31.1 bits (67), Expect = 0.89 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSP-LPPSWRGPESLPRSTPVPPSQ 441 T ++P +P+P T +P P + P + P TPVPP+Q Sbjct: 680 TTVSPGTPVPPTDDPDCTTETPDTQPPTQPPVTQPPDTPVPPTQ 723 >SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1926 Score = 31.1 bits (67), Expect = 0.89 Identities = 15/46 (32%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 331 SPIPNASATPFRTPSPLPPSWRGPESLP-RSTPVPPSQFQPQLDGE 465 +P P P R P PP++R P P +TP PQ G+ Sbjct: 1752 APTPRTQQPPARAPPAQPPTYRNPAQAPFEATPREHLPKAPQASGQ 1797 >SB_56567| Best HMM Match : PDZ (HMM E-Value=5.6e-20) Length = 285 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +1 Query: 130 VTPGTPAGRD--LVRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVE 288 +TP PA + L GDI+ ++D L H A + K+ ++L +++ E Sbjct: 181 ITPNGPADKHGGLRPGDILLAVNDRSLVGLEHSQAVRILKSVSGTVRLTVKKSRE 235 >SB_47804| Best HMM Match : E-MAP-115 (HMM E-Value=1.4) Length = 402 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +1 Query: 484 SPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPN 627 +P S T E I SI + P+R TPL + P +++ + HP+ Sbjct: 79 TPRSVHTHEEIHPSIGTDPWRNTPLYQYRPMKKHTPLSVQTHEKIHPS 126 >SB_43489| Best HMM Match : BB1 (HMM E-Value=3.8) Length = 227 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 Query: 328 RSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 RSP+P P P P GPE +P+STP P Sbjct: 153 RSPMPGYCTGPEMIPGP--EKIPGPEMIPKSTPTDP 186 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 30.7 bits (66), Expect = 1.2 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +1 Query: 370 PSPLPPSWRGPESL-PRSTPVPPSQFQPQLDGEYRTYLLSPSS 495 PSP+ P E+L PRST VPP+ Q ++ E RT L P S Sbjct: 243 PSPIMPPKPSLEALTPRSTSVPPAG-QTKVGREDRTMLPEPPS 284 >SB_49341| Best HMM Match : Rad21_Rec8_N (HMM E-Value=2.3) Length = 549 Score = 30.7 bits (66), Expect = 1.2 Identities = 35/120 (29%), Positives = 49/120 (40%), Gaps = 6/120 (5%) Frame = +1 Query: 226 AQNLFK-NAPNQIKLVIQRDVEREGLRGSG-TPLAPRSPIP-NASATPFRTPSPLPPSWR 396 +QN F N P ++L+ R + R S +P ++ I N +TP TP PS Sbjct: 333 SQNSFSLNGPGALELM--RGSSQNSSRASTPSPTMGKTLIQYNPVSTPSNTPPVSTPSHT 390 Query: 397 GPESLPRSTP--VPPSQFQPQLDGEYRTYLLSPSSTRTDETIDESIQ-SQPYRTTPLVLP 567 P S P TP PS P + + +PS T T + S P T P+ P Sbjct: 391 PPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSNTPPVSTPSHTPPVSTP 450 Score = 29.9 bits (64), Expect = 2.1 Identities = 25/87 (28%), Positives = 36/87 (41%), Gaps = 3/87 (3%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTP--VPPSQFQPQLDGEYRTYLLSP 489 P++ S P S TP TP PS P S P +TP PS P + + +P Sbjct: 455 PVSTPSHTPPVS-TPSHTPPVSTPSHTPPVSTPSNTPPVFTPSHTPPVFTPSHTPPVSTP 513 Query: 490 SSTRTDETIDESIQ-SQPYRTTPLVLP 567 S++ T ++ P T P+ P Sbjct: 514 SNSPPVSTPSNTLPVFTPSHTPPVSTP 540 >SB_33596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 881 Score = 30.7 bits (66), Expect = 1.2 Identities = 26/83 (31%), Positives = 31/83 (37%), Gaps = 4/83 (4%) Frame = +1 Query: 388 SWRGPESLP--RSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETIDESIQS-QPYRTTPL 558 S+ P +P R P PS Q LS T + S S QPY T Sbjct: 479 SYNAPSGMPTHREPPPHPSFASHQPYHVTSCDALSGMQTHREPPPHPSFASHQPYHVTSC 538 Query: 559 -VLPGAKVRREPGPTESYLRHHP 624 L G + REP P S+ H P Sbjct: 539 DALSGMQTHREPPPHPSFASHQP 561 Score = 30.3 bits (65), Expect = 1.6 Identities = 30/99 (30%), Positives = 37/99 (37%), Gaps = 4/99 (4%) Frame = +1 Query: 340 PNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS--TRTDET 513 P SA P PS S L ST + P+ + T +PS T + Sbjct: 437 PPVSACPSHQPSHATMS---DARLNTSTHLAPTPHHSSDRPHHATSYNAPSGMPTHREPP 493 Query: 514 IDESIQS-QPYRTTPL-VLPGAKVRREPGPTESYLRHHP 624 S S QPY T L G + REP P S+ H P Sbjct: 494 PHPSFASHQPYHVTSCDALSGMQTHREPPPHPSFASHQP 532 >SB_17101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +1 Query: 316 PLAPRSPI---PNASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 P +PRSP+ P P P P GPE +P+STP P Sbjct: 78 PASPRSPLFVLPGLCTGPEMIPGP--EMIPGPEMIPKSTPTDP 118 >SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) Length = 3037 Score = 30.3 bits (65), Expect = 1.6 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Frame = +1 Query: 358 PFRTPSPLPPSWRGPESLPRSTPVPPSQFQ-PQLDGEYRTYLLS--PSSTRTDETIDESI 528 PF TP P P + PR +PVP S+ + PQL ++ S + R +T D S Sbjct: 2307 PFSTPVPKSSPINSPLTSPRDSPVPFSRAKSPQLSVDFAPITESSVKLNVRLPQTSDSSH 2366 Query: 529 QS 534 Q+ Sbjct: 2367 QN 2368 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 30.3 bits (65), Expect = 1.6 Identities = 26/76 (34%), Positives = 34/76 (44%), Gaps = 4/76 (5%) Frame = +1 Query: 307 SGTPLA-PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLL 483 SG PL PR P+P P + PLPP P P P+ PS+ D ++ Y Sbjct: 1338 SGLPLPLPRLPLPPLRLPPPHSRLPLPPPKLPP---PSRIPL-PSKLSTNKDIKFHPYHN 1393 Query: 484 SPSSTR---TDETIDE 522 SST+ TD + E Sbjct: 1394 VVSSTKFATTDRILPE 1409 >SB_20828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 354 Score = 30.3 bits (65), Expect = 1.6 Identities = 25/89 (28%), Positives = 37/89 (41%), Gaps = 6/89 (6%) Frame = +1 Query: 406 SLPRSTPVPPSQFQPQLDGEYRTYLLS---PSSTRTDETIDESIQSQPYRTTPLVLPGAK 576 ++P T VP S YR L+ PS TR +++ S+ YR T + Sbjct: 250 AVPSHTHVPSSTESHSCSERYRVTLVFRAVPSHTRVLSSVESHSCSEQYRVTLVFRAVPS 309 Query: 577 VRREPGPTESYL---RHHPNPAMRAPPNH 654 R P TES+ ++ RA P+H Sbjct: 310 HTRVPSSTESHSCSEQYRVTLMFRAVPSH 338 >SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1929 Score = 30.3 bits (65), Expect = 1.6 Identities = 37/152 (24%), Positives = 62/152 (40%), Gaps = 8/152 (5%) Frame = +1 Query: 256 QIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 +IKL++++D G +P++PRSP P P + SP + RST Sbjct: 1630 KIKLMLKKDRS-----GGSSPVSPRSPSPCEPRLPLESRSPFESN---SSFQSRSTTESR 1681 Query: 436 SQFQPQLDGEYRTYLLSPSSTRTDETIDESIQSQPYRTTPL----VLPG-AKVRREP--G 594 S + +L E R S + + ++P P+ LP KV +P Sbjct: 1682 SSAESRLPAESRLPAESRLPYESHSPYESRYPTEPSSAYPITVIKTLPAPPKVSAKPATA 1741 Query: 595 PTESYLRHHPNPAMRAPPNHD-YRDTLMKQKV 687 P + + P + PP+ D Y D + ++ V Sbjct: 1742 PKPAGILAKPFKPVVTPPSFDSYLDHVAERGV 1773 >SB_5589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 583 Score = 30.3 bits (65), Expect = 1.6 Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 4/87 (4%) Frame = +1 Query: 295 GLRGSGTPLAPRSPIPNASATPFRTPSPL---PPSWRGPESLPRSTPVPPSQFQPQ-LDG 462 G R + P + P +A TP TP PP P + P ++ P + P + Sbjct: 195 GSRSTPEP-SLEEPEVSAMGTPVSTPQATVQTPPPPPEPSNEPSTSSKPKASPSPSSITT 253 Query: 463 EYRTYLLSPSSTRTDETIDESIQSQPY 543 T+ + ++T TDE + E QPY Sbjct: 254 STSTFEATSTTTATDEDMSEGQLIQPY 280 >SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8) Length = 170 Score = 30.3 bits (65), Expect = 1.6 Identities = 29/83 (34%), Positives = 36/83 (43%), Gaps = 6/83 (7%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPE-----SLPRSTPVPPSQFQPQLDGEYRTYLLSP 489 P P N + P +TPS +PP + E S P STP P P+L R L +P Sbjct: 89 PAKPALNLPSPPSKTPSSVPPQAKVDETPLLPSPPTSTPRP--SHIPRLK---RRRLQTP 143 Query: 490 SSTRTDETIDESIQSQ-PYRTTP 555 + T T I Q Q P R P Sbjct: 144 TKTTTLPPIHSPPQDQHPGRQLP 166 >SB_57156| Best HMM Match : DUF1456 (HMM E-Value=4.9) Length = 501 Score = 29.9 bits (64), Expect = 2.1 Identities = 31/128 (24%), Positives = 53/128 (41%), Gaps = 9/128 (7%) Frame = +1 Query: 103 EPRNFGQRKVTP--GTPAGRDLVRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQ 276 +P+ +G++ + P P D G+I ++ RD +DA L ++A ++I + Sbjct: 134 QPKQWGRKTLVPMEEVPKVPDTGLGEIPPQLLAGPTRDKVLDDANELLQSAKDEISSLPL 193 Query: 277 RDVEREGL-----RGSGTPLAPRSPIPNASATPFRTPSPLP--PSWRGPESLPRSTPVPP 435 R GL + S P P S ++ + F PS + P + PRS +P Sbjct: 194 SGTSRSGLSSASFQSSDKPSRPFSGKSDSDTSHFMAPSSSACLDTNHNPLTPPRSYGLPD 253 Query: 436 SQFQPQLD 459 LD Sbjct: 254 DDLYLGLD 261 >SB_44668| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-05) Length = 1604 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTP--SPLPPSWRGPESLPRSTPVP 432 TPL P+P + P P P+P R P LP PVP Sbjct: 412 TPLPLERPVPAVTRLPTHLPLERPVPAVTRLPTHLPLEQPVP 453 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTP--SPLPPSWRGPESLPRSTPVP 432 T L P+P + P P PLP R P LP PVP Sbjct: 300 THLPLERPVPTVTCLPTHLPLQRPLPAVTRLPTHLPLEQPVP 341 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTP--SPLPPSWRGPESLPRSTPVP 432 T L P+P ++ P P PLP R P LP PVP Sbjct: 636 THLPLEQPVPAVTSLPTHLPLERPLPDVTRLPTHLPLERPVP 677 Score = 28.3 bits (60), Expect = 6.3 Identities = 35/120 (29%), Positives = 45/120 (37%), Gaps = 6/120 (5%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTP--SPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLS 486 T L P+P + P P P+P R P LP PVP P R Sbjct: 428 THLPLERPVPAVTRLPTHLPLEQPVPAVTRLPTHLPLERPVPAVTCLPTHLPLERPV--- 484 Query: 487 PSSTR--TDETIDESIQSQPYRTT--PLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNH 654 P+ TR T ++ + + + T PL P V R P P L P PA+ P H Sbjct: 485 PAVTRLPTPLPLERPVPAVTHLPTDLPLERPVPAVTRLPTP---LLLERPVPAVTHLPAH 541 Score = 27.9 bits (59), Expect = 8.3 Identities = 34/119 (28%), Positives = 45/119 (37%), Gaps = 5/119 (4%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTP--SPLPPSWRGPESLPRSTPVPP-SQFQPQLDGEYRTYLL 483 T L P+P + P P P+P R P LP PVP ++ L E Sbjct: 332 THLPLEQPVPAVTRLPTHLPLERPVPAVTRLPTDLPLERPVPAVTRLPTHLPLERPV--- 388 Query: 484 SPSSTR--TDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNH 654 P+ TR T ++ + + TTPL L PT L P PA+ P H Sbjct: 389 -PAVTRLPTHLPLERPVPAVTRFTTPLPLERPVPAVTRLPTHLPL-ERPVPAVTRLPTH 445 >SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.9 bits (64), Expect = 2.1 Identities = 28/112 (25%), Positives = 41/112 (36%), Gaps = 1/112 (0%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPS 492 TP P P ++A TP+P PS P + ++TP P + + T S Sbjct: 35 TPTKPSPTTPTSTAPTQTTPTPTTPS---PTAPTQTTPTPATPTPTTPTPKTPTPTTSTL 91 Query: 493 STRTDETIDESIQSQPYRTTPLV-LPGAKVRREPGPTESYLRHHPNPAMRAP 645 + T T + P TP P A +P P ++ P P P Sbjct: 92 TKPTPATTPTPTKPTPTAHTPTTPTPTAHTPTKPTP-KTPTPTTPTPTAHTP 142 >SB_26911| Best HMM Match : Trypsin (HMM E-Value=0) Length = 349 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 364 RTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGE 465 R P + GP S R +PPSQF+ DG+ Sbjct: 59 RKSGTTPSTGTGPSSGQRGKDIPPSQFRCNFDGD 92 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +1 Query: 331 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQF 444 SP + S +PFR+P + PE LP +PV S F Sbjct: 195 SPFRHKSRSPFRSPQKERIPHQSPERLPSWSPVRQSPF 232 Score = 29.5 bits (63), Expect = 2.7 Identities = 22/73 (30%), Positives = 28/73 (38%), Gaps = 7/73 (9%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRG------PESLPRSTPVPPSQFQ-PQLDGEYRT 474 PL P P P P PLPP G P + P+ P+PP P L + Sbjct: 458 PLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPPKHSNGPPLRQTPMS 517 Query: 475 YLLSPSSTRTDET 513 LS + T +T Sbjct: 518 SSLSATPVSTPDT 530 >SB_39767| Best HMM Match : CBAH (HMM E-Value=0.86) Length = 1182 Score = 29.9 bits (64), Expect = 2.1 Identities = 19/45 (42%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 298 LRGSGTPLAPRSPIPNASATPFRTPSPL--PPSWRGPESLPRSTP 426 L+ + P P SP AS P RTP PL PS ES P + P Sbjct: 633 LKTTPAPTTPTSPATPASDAPIRTPIPLKETPS-SALESAPAAMP 676 >SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5659 Score = 29.9 bits (64), Expect = 2.1 Identities = 22/84 (26%), Positives = 35/84 (41%), Gaps = 2/84 (2%) Frame = +1 Query: 310 GTPLAPRSPI-PNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLS 486 GT +AP + + P + P T P G P+ST +PP+ P+ T + Sbjct: 2538 GTTMAPETTVVPATTKAPESTVIPDSTVAPGTTITPKSTELPPTTMTPESTVTPATTMTP 2597 Query: 487 PSSTRTDETIDESIQSQPYRT-TP 555 S+ T+ +P +T TP Sbjct: 2598 ESTVAPGTTMAPESTLEPEKTMTP 2621 Score = 29.5 bits (63), Expect = 2.7 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Frame = +1 Query: 313 TPLAPRSPI-PNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSP 489 T +AP S + P + P T P G P+ST VPP+ + T ++P Sbjct: 2359 TTMAPESTVVPPTTIAPESTEIPNSTVVPGTTISPKSTEVPPTTMTAESTVAPGT-TMAP 2417 Query: 490 SSTRTDET 513 ST T ET Sbjct: 2418 ESTVTPET 2425 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPV 429 TP +P+ + PF P P PP P P STPV Sbjct: 360 TPAPTPAPLSSTPCAPFAPPPPPPPP---PPPAPGSTPV 395 >SB_1657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 29.9 bits (64), Expect = 2.1 Identities = 27/87 (31%), Positives = 37/87 (42%) Frame = +1 Query: 175 IIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASA 354 ++ K+D+ A L E+ Q F+N P DV G G P A S +S+ Sbjct: 14 LLEKVDNTAANVLTKEEQQGYFRNIP--------LDVPESGDEGVSQPPADLS----SSS 61 Query: 355 TPFRTPSPLPPSWRGPESLPRSTPVPP 435 T + S + PS LP STP P Sbjct: 62 TRVKDTSQIGPSAPTRPRLPVSTPRQP 88 >SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) Length = 246 Score = 29.5 bits (63), Expect = 2.7 Identities = 20/63 (31%), Positives = 28/63 (44%) Frame = +1 Query: 271 IQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 I + E+ S TP + P P +S+ P +P P PP S P S+ +PP P Sbjct: 137 INSNPEKRAYAPSSTPSSSLLP-PPSSSPPLSSPPPPPP------STPSSSLLPPPSSSP 189 Query: 451 QLD 459 D Sbjct: 190 LQD 192 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 322 APRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 453 AP +P P A+A P PP+ P + P PP+Q PQ Sbjct: 61 APAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQ 104 >SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/75 (24%), Positives = 30/75 (40%) Frame = +1 Query: 163 VRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIP 342 V G ++KI + ++ R + +N P + K + + E + P IP Sbjct: 681 VGGTPVSKIPSFSSKLQRKPSEEKHVENKPVENKPAETKQADNEPVFDKSKPNDEDKEIP 740 Query: 343 NASATPFRTPSPLPP 387 AT + P P PP Sbjct: 741 PPPATAAKAPPPPPP 755 >SB_47005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 289 Score = 29.5 bits (63), Expect = 2.7 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Frame = +1 Query: 298 LRGSGTPLAPRSPIPNASATPFRTPSPL-----PPSWRGPESLPRST 423 L + P P SP S P RTP PL P PE++P +T Sbjct: 32 LETTPAPTTPTSPATPTSGPPIRTPIPLKETPTPALESAPEAMPDAT 78 >SB_42387| Best HMM Match : CH (HMM E-Value=2.7) Length = 703 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPL 381 P P SP+ AS P RTP PL Sbjct: 200 PTTPTSPVTPASGPPIRTPIPL 221 >SB_36926| Best HMM Match : Flocculin (HMM E-Value=0.93) Length = 206 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +1 Query: 295 GLRGSGT-PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRS 420 GL G+GT A + +P + PF TPS +P S P + S Sbjct: 129 GLLGNGTVATASSNNLPATTPGPFSTPSAIPQSSTAPSATASS 171 >SB_23868| Best HMM Match : Gal_Lectin (HMM E-Value=1.4e-05) Length = 318 Score = 29.5 bits (63), Expect = 2.7 Identities = 20/76 (26%), Positives = 32/76 (42%) Frame = +1 Query: 328 RSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTD 507 R P+P A P P PL P+ S P + + + + D + +L + T Sbjct: 135 RQPMPKAKQLPTWDPRPLHPARSRRLSHPATAKKDETHTESRQDMGLQLRVLVVTHTVRV 194 Query: 508 ETIDESIQSQPYRTTP 555 +T+ E +Q TTP Sbjct: 195 KTLQEVAMTQGLTTTP 210 >SB_15424| Best HMM Match : PAN (HMM E-Value=0.00016) Length = 702 Score = 29.5 bits (63), Expect = 2.7 Identities = 33/124 (26%), Positives = 50/124 (40%), Gaps = 8/124 (6%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRT 504 P P P PF P P++R P+S P P F+ + + LS ++T Sbjct: 378 PHFPAPTFRV-PFSEPHSQSPTFRAPQSEPH---FPAPTFRVPFSELHIKFPLSEPHSQT 433 Query: 505 DETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLR------HHPNPAMRAPPN--HDY 660 + QS+P+ +P V + EP S +R H +P +RAP + H Sbjct: 434 PTF--RAPQSEPHSQSPTV---RAPQSEPHSQSSTVRAPQSEPHSQSPTVRAPQSELHSQ 488 Query: 661 RDTL 672 TL Sbjct: 489 SPTL 492 >SB_54886| Best HMM Match : SH3_2 (HMM E-Value=3.2e-24) Length = 440 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 5/58 (8%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRG-----PESLPRSTPVPPSQFQPQLDGEYR 471 TP R+ + + PF PS + P W G + RS VP S ++ ++GEY+ Sbjct: 131 TPSKIRAGCLCSGSLPFYDPSIMTPFWAGWTLPDMDEFGRSNGVPISGYKVYVNGEYK 188 >SB_39621| Best HMM Match : Extensin_2 (HMM E-Value=0.078) Length = 539 Score = 29.5 bits (63), Expect = 2.7 Identities = 31/134 (23%), Positives = 53/134 (39%) Frame = +1 Query: 241 KNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRS 420 ++A IK + + G + + + S + AS T ++ SP PESLP Sbjct: 266 RSASMSIKRPARPERSTAGSTSTESSSSAASSVTVASDTGYQMKSP-------PESLPSP 318 Query: 421 TPVPPSQFQPQLDGEYRTYLLSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPT 600 P+PP ++ + R + T+ + +Q R+ P G V+ G Sbjct: 319 PPLPPQDYEEEPLHNKRKVRPRHERSATEPVCMQDVQQAVQRSYPTSSAGT-VKSSQGSL 377 Query: 601 ESYLRHHPNPAMRA 642 ++ R P P RA Sbjct: 378 KTSPR--PPPPRRA 389 >SB_39566| Best HMM Match : Pyocin_S (HMM E-Value=3.3) Length = 736 Score = 29.5 bits (63), Expect = 2.7 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +1 Query: 298 LRGSGTPLAPRSPIPNASATPFRTPSPLPPS-WRGPESLPRSTP 426 L+ + P P SP AS P RTP PL + ES P + P Sbjct: 61 LQTTPAPTTPTSPATPASGPPIRTPIPLKETPTPALESAPAAMP 104 >SB_32226| Best HMM Match : PID (HMM E-Value=3.9e-30) Length = 591 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +1 Query: 340 PNASATPFRTPSPLPPSWRGPESLPRSTPVP--PSQFQPQLDGEYRTYLLS 486 P+++A T +PP+ + P + RS P P PS F + YR+ +S Sbjct: 308 PSSTAPVVTTTQQVPPALKPPPAAARSRPQPFAPSPFTRHMSLRYRSTPMS 358 >SB_24292| Best HMM Match : LTXXQ (HMM E-Value=1.7) Length = 288 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 310 GTPLAPRSPIPNASATPFRTPSP--LPPSWRGPESLPRSTPVPPSQ 441 G PL SP+ ++ +P T SP PPS+ S+PR P + Sbjct: 11 GVPLEVPSPLSFSTLSPLATSSPRRTPPSFTPRSSIPRRRSDTPKK 56 >SB_23539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1041 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 298 LRGSGTPLAPRSPIPNASATPFRTPSPL 381 L + P P SP AS P RTP PL Sbjct: 492 LETTSAPTTPTSPATPASGAPIRTPVPL 519 >SB_57005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/52 (26%), Positives = 20/52 (38%) Frame = +2 Query: 326 HVRPYPTQAPHHSGLQARCLRHGVVRNLCLAAHRCHLRNSSHNWTANTEPIC 481 + R TQ H L+ H R LC H + +H +NT +C Sbjct: 199 NTRTLCTQTHAHCALKHTHAMHSNTRTLCTETHAHYALKHTHTMHSNTRTLC 250 >SB_56900| Best HMM Match : I-set (HMM E-Value=8e-10) Length = 968 Score = 29.1 bits (62), Expect = 3.6 Identities = 27/115 (23%), Positives = 46/115 (40%), Gaps = 3/115 (2%) Frame = +1 Query: 325 PRSPIPNASATPFRTP-SPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTR 501 P +P + T TP +P P + STP P P+L EY T+ +PS+ Sbjct: 763 PVNPRLHTQYTHTYTPGTPTPTQREYTHAYTPSTPTPTRPVHPRLHTEY-THAYTPSTPS 821 Query: 502 TDETIDESIQSQ-PYRTTPL-VLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDY 660 + + ++ + TP+ A+ P+ H +P++ A H Y Sbjct: 822 PTHRVHTRLHTKYTHAYTPIHPRLHAEYTHAYTPSTPKPTHRVHPSLHAGYTHTY 876 >SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 29.1 bits (62), Expect = 3.6 Identities = 26/97 (26%), Positives = 40/97 (41%), Gaps = 1/97 (1%) Frame = +1 Query: 358 PFRTPSPLPPSWRGPESLPRSTPVPPS-QFQPQLDGEYRTYLLSPSSTRTDETIDESIQS 534 P PS PS + P P P+ P Q+Q + G + PSST + + S Sbjct: 448 PQGPPSQSTPSQQAP---PTKQPMQPQHQYQARPGGPPQQRQYPPSST-PQQGFPQRPGS 503 Query: 535 QPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAP 645 P + P PG ++++ P P + P M+ P Sbjct: 504 PP-TSQPGGFPGQQMQQHPAPLPTSQPSFPGQQMQRP 539 >SB_45934| Best HMM Match : Gp-FAR-1 (HMM E-Value=2) Length = 694 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/44 (38%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +1 Query: 298 LRGSGTPLAPRSPIPNASATPFRTPSPLPPS-WRGPESLPRSTP 426 L + P P SP AS P RTP PL + ES P + P Sbjct: 140 LETTPAPTTPTSPATPASGPPIRTPIPLKETPTPALESAPAAMP 183 >SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) Length = 1230 Score = 29.1 bits (62), Expect = 3.6 Identities = 25/89 (28%), Positives = 33/89 (37%), Gaps = 6/89 (6%) Frame = +1 Query: 319 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP-----SQFQPQLDGEY-RTYL 480 LAP P A P + P+P+PP + P P T P + F PQ Y Sbjct: 880 LAPYEPF----ARPQQPPAPMPPQQQSPYQPPAPTMQQPQLQAFAPFSPQPSQPYINPDA 935 Query: 481 LSPSSTRTDETIDESIQSQPYRTTPLVLP 567 +S T E + Q Y P +P Sbjct: 936 FHNTSPFTPEDTSKGDDEQYYHDQPAAVP 964 Score = 27.9 bits (59), Expect = 8.3 Identities = 20/82 (24%), Positives = 35/82 (42%), Gaps = 2/82 (2%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL--DGEYRTYLLSP 489 P P +P+P +P++ P+ P+ + P+ L P P QP + D + T +P Sbjct: 889 PQQPPAPMPPQQQSPYQPPA---PTMQQPQ-LQAFAPFSPQPSQPYINPDAFHNTSPFTP 944 Query: 490 SSTRTDETIDESIQSQPYRTTP 555 T + ++ QP P Sbjct: 945 EDTSKGDD-EQYYHDQPAAVPP 965 >SB_20163| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 349 SATPFRTPSPLPPSWRGPESLPRSTPVPP 435 SATP P GPE +P+STP P Sbjct: 119 SATPQVDQEPSKKGCTGPEMIPKSTPTDP 147 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 29.1 bits (62), Expect = 3.6 Identities = 39/167 (23%), Positives = 62/167 (37%), Gaps = 16/167 (9%) Frame = +1 Query: 85 RVDPEDEPRNFGQRKVT---PGTPAGRDLVRGDIIAKI---DDYDARDLRHEDAQNLFKN 246 R P + + GQ+ G GR + D++++I YD +D ++ + + ++ Sbjct: 77 RASPSPQQQFSGQQAFVYQQDGMANGRGNEQEDMLSQIRMRQGYDQQDHEYQRSTSQDRH 136 Query: 247 -APNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPS---------WR 396 A K +Q G + P P +P P P+P PP + Sbjct: 137 IAMTTRKAQVQVSASSSGPSIASQPPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFG 196 Query: 397 GPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETIDESIQSQ 537 GP S P P PP L + L SS +E D I+ Q Sbjct: 197 GPPSAPPPPPAPPVGGGGSLADQLAAAKLRKSS--RNEAADGGIREQ 241 >SB_208| Best HMM Match : zf-C2H2 (HMM E-Value=1.7) Length = 836 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/45 (35%), Positives = 20/45 (44%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLD 459 P P+ +A A + P PP W PE P PP P+LD Sbjct: 375 PDLPVDSARARSPQAPESDPPMWTAPE------PDPPMWTTPELD 413 >SB_58610| Best HMM Match : RVT_1 (HMM E-Value=0.061) Length = 1445 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPS-WRGPESLPRSTP 426 TP P SP AS P RTP PL + ES P + P Sbjct: 467 TPTTPISPAIPASGRPIRTPIPLKETPTPALESAPAAMP 505 >SB_43553| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.29) Length = 1851 Score = 29.1 bits (62), Expect = 3.6 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPL--PPSWRGPESLPRSTP 426 P P SP AS P RTP PL PS ES P + P Sbjct: 40 PTTPTSPATPASGAPIRTPIPLKETPS-PALESAPAAMP 77 >SB_40783| Best HMM Match : MH2 (HMM E-Value=0) Length = 494 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 331 SPIPNASATPFRTPSPLPPSWRGPESLP 414 SP+P S P R P PLPP +R + P Sbjct: 133 SPVPRQSEYP-RPPPPLPPPFRATDDPP 159 >SB_24167| Best HMM Match : FF (HMM E-Value=9.2) Length = 482 Score = 29.1 bits (62), Expect = 3.6 Identities = 18/47 (38%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +1 Query: 289 REGLRGSGTPLAPRSPIPNASATPFRTPSPLPPS-WRGPESLPRSTP 426 R+ R P P SP AS P RTP PL + ES P + P Sbjct: 5 RKTPRDYPAPTTPTSPATPASGPPIRTPIPLKETPTPALESAPAAMP 51 >SB_18429| Best HMM Match : FF (HMM E-Value=9.2) Length = 456 Score = 29.1 bits (62), Expect = 3.6 Identities = 18/47 (38%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +1 Query: 289 REGLRGSGTPLAPRSPIPNASATPFRTPSPLPPS-WRGPESLPRSTP 426 R+ R P P SP AS P RTP PL + ES P + P Sbjct: 5 RKTPRDYPAPTTPTSPATPASGPPIRTPIPLKETPTPALESAPAAMP 51 >SB_12700| Best HMM Match : POPLD (HMM E-Value=1.9) Length = 461 Score = 29.1 bits (62), Expect = 3.6 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPL--PPSWRGPESLPRSTP 426 P P SP AS P RTP PL PS ES P + P Sbjct: 33 PTTPTSPATPASVAPIRTPIPLKETPS-PALESAPAAMP 70 >SB_10727| Best HMM Match : Drf_FH1 (HMM E-Value=3.8) Length = 215 Score = 29.1 bits (62), Expect = 3.6 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +1 Query: 286 EREGLRGSGTPLAP--RSPIPNASATPFRTPSPLPPSWRGPES 408 ER + S TPL P RS +S P P P+P S +GP S Sbjct: 95 ERPSMLHSHTPLFPPVRSASSASSFEPVSPPPPVPFSSKGPPS 137 >SB_10217| Best HMM Match : ubiquitin (HMM E-Value=1.6e-06) Length = 479 Score = 29.1 bits (62), Expect = 3.6 Identities = 31/103 (30%), Positives = 43/103 (41%), Gaps = 6/103 (5%) Frame = +1 Query: 313 TPLAPRS-PIPNASATPFRTPSPLPPSWRGPESL-PRSTPV-PPSQFQPQLDGEYRTYLL 483 TP P S P P +SATP R P P+ + L R TP+ PS F L ++ Sbjct: 99 TPTPPLSQPSPASSATPTRVPDSTSPTPAQADGLRHRGTPMQTPSPFNYPLGLPQMHFMQ 158 Query: 484 SPSSTRTDETIDESIQSQPYRTTPLV---LPGAKVRREPGPTE 603 P + + + + P TTP V LP + P P + Sbjct: 159 HP------QHVGLTFATPPSPTTPPVDQQLPQQQAPPPPPPAD 195 >SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1041 Score = 24.6 bits (51), Expect(2) = 4.0 Identities = 23/87 (26%), Positives = 35/87 (40%), Gaps = 6/87 (6%) Frame = +1 Query: 406 SLPRSTPVPPSQFQP-----QLDGEYRTYLLSPSSTRTDETIDESIQSQPYRTTPLVLPG 570 S P S PV P Q+QP Y+ + + ++ +S P P P Sbjct: 490 SPPASAPVTPQQYQPPRHAVPTSQPYQAVQRPFNGQYQQQQAYQAARSPPAPGQPQYHPA 549 Query: 571 AKVR-REPGPTESYLRHHPNPAMRAPP 648 +++ + PG +Y R H P R PP Sbjct: 550 QQIQYQNPG---NY-RVHRGPPQRPPP 572 Score = 22.6 bits (46), Expect(2) = 4.0 Identities = 15/62 (24%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Frame = +1 Query: 235 LFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLP--PSWRGPES 408 +++ PN ++ + V+ E + P P+ + P + P P P PS R P Sbjct: 392 IYEPIPNATPIMAKDAVKYEPPQQQPQQQRQSPPQPSPTGAPPQRPHPPPQQPSPRPPMG 451 Query: 409 LP 414 +P Sbjct: 452 VP 453 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +1 Query: 295 GLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 G GT P+P T T P PP P P P PP P Sbjct: 1005 GPTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPP 1056 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 28.7 bits (61), Expect = 4.8 Identities = 22/58 (37%), Positives = 25/58 (43%), Gaps = 3/58 (5%) Frame = +1 Query: 334 PIPNASATPFRTPSPLPPSWRGPESLPR-STPVPPSQFQP--QLDGEYRTYLLSPSST 498 PIP + P P P PP P P+ STP PP P Q G + SPS T Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGT 732 >SB_53945| Best HMM Match : POPLD (HMM E-Value=1) Length = 465 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPS-WRGPESLPRSTP 426 P P SP AS P RTP PL + ES P + P Sbjct: 38 PTTPTSPATPASGPPIRTPIPLKETPTPALESAPAAMP 75 >SB_32383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1850 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +1 Query: 304 GSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTP 426 G G AP + P+ P+ PPS G E++P +TP Sbjct: 918 GGGNETAPTATPPSGGGNE-TAPTATPPSGVGNETVPTATP 957 >SB_23088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Frame = +1 Query: 298 LRGSGTPLAPRSPIPNASATPFRTPSPL-----PPSWRGPESLPRST 423 L + P P SP AS P RTP PL P P ++P +T Sbjct: 36 LETTPAPTTPTSPATPASGPPIRTPIPLRETPTPALESAPAAMPDAT 82 >SB_20236| Best HMM Match : Pec_lyase_N (HMM E-Value=6.6) Length = 697 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPS-WRGPESLPRSTP 426 P P SP AS P RTP PL + ES P + P Sbjct: 40 PTTPTSPATPASGPPIRTPIPLKETPTPALESAPAAMP 77 >SB_56225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 494 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWR-GPESLPRSTP 426 P P SP AS P RTP PL + ES P + P Sbjct: 91 PTTPTSPATPASGPPIRTPIPLKETPNPALESAPAAIP 128 >SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +1 Query: 310 GTP-LAPRSPIPNASATPFRTPSPLPPSWRGPESL 411 G P + P++P P + PF P P PPS SL Sbjct: 68 GQPQVTPQTPSPASPGLPFMPPPPPPPSTEDLSSL 102 >SB_37150| Best HMM Match : 7tm_1 (HMM E-Value=0.011) Length = 211 Score = 28.7 bits (61), Expect = 4.8 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPL--PPSWRGPESLPRSTP 426 P P SP ASA P R P PL PS ES P + P Sbjct: 167 PTTPTSPATPASAAPIRAPIPLKETPS-PALESAPAAMP 204 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 340 PNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 453 P PF TP P P + R LP P P Q P+ Sbjct: 112 PTLPTPPFSTPRPRPKAKRIRRLLPTPPPPTPPQSTPK 149 >SB_26558| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 879 Score = 28.7 bits (61), Expect = 4.8 Identities = 21/68 (30%), Positives = 31/68 (45%) Frame = +1 Query: 184 KIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPF 363 K+ + D DL D+ LF+N L + + L TP RS P+ + +P Sbjct: 331 KLKESDLSDLLSPDSP-LFRNKRKSGDL-LSASGYLDSLVSPNTPNT-RSDTPSGTISPQ 387 Query: 364 RTPSPLPP 387 TP P+PP Sbjct: 388 ATPKPVPP 395 >SB_22331| Best HMM Match : fn3 (HMM E-Value=7.1e-14) Length = 908 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/41 (39%), Positives = 19/41 (46%), Gaps = 5/41 (12%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPL-----PPSWRGPESLPRST 423 P P SP AS P RTP PL P P ++P +T Sbjct: 438 PTTPNSPATPASGPPIRTPIPLRETPTPALESAPAAMPDAT 478 >SB_8646| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-27) Length = 522 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPS-WRGPESLPRSTP 426 P P SP AS P RTP PL + ES P + P Sbjct: 432 PTTPTSPATPASGPPIRTPIPLKETPTPALESAPAAMP 469 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 453 P A P+P+ +A+ + P PP+ P+ P + P P + PQ Sbjct: 132 PGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYP-AQPYPQQGYPPQ 176 >SB_41879| Best HMM Match : DUF1658 (HMM E-Value=7) Length = 180 Score = 28.3 bits (60), Expect = 6.3 Identities = 18/70 (25%), Positives = 30/70 (42%), Gaps = 1/70 (1%) Frame = +1 Query: 409 LPRSTPVPPSQFQPQLDG-EYRTYLLSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRR 585 L + TP S P R+ + +TDE+ + + + +++TP PG + RR Sbjct: 79 LVKKTPPKQSNLTPPKPTYSLRSSPRKGQAIKTDESPSRNARQKGHKSTPKSSPGVETRR 138 Query: 586 EPGPTESYLR 615 P S R Sbjct: 139 SPRGAHSVPR 148 >SB_40933| Best HMM Match : DUF548 (HMM E-Value=1.7) Length = 682 Score = 28.3 bits (60), Expect = 6.3 Identities = 16/41 (39%), Positives = 19/41 (46%), Gaps = 5/41 (12%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPL-----PPSWRGPESLPRST 423 P P SP AS P RTP PL P P ++P +T Sbjct: 131 PTTPTSPATPASGPPIRTPIPLKETPTPELESAPAAMPDAT 171 >SB_34181| Best HMM Match : Extensin_2 (HMM E-Value=0.57) Length = 1121 Score = 28.3 bits (60), Expect = 6.3 Identities = 29/107 (27%), Positives = 46/107 (42%), Gaps = 4/107 (3%) Frame = +1 Query: 304 GSGTPLAPRSPIPNASATPFRTPSPLPPSWRGP--ESLPRSTPVPPSQFQPQLDGEYRTY 477 G+ TPL P +P P +A+ P P P+ + E + ++ PPS P ++R Sbjct: 844 GTPTPLRPTNPTPAHAASKPSNPRPSNPTPKHAMGEGVSDNSAEPPS---PGESPQWRNN 900 Query: 478 LLSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREP--GPTESYL 612 L S +E D+ I + R+ P + EP GP Y+ Sbjct: 901 LESVQEVTANEQ-DDGIANAVPRSEEDDEPISDTPGEPKFGPRSLYI 946 >SB_29692| Best HMM Match : ig (HMM E-Value=5.4e-12) Length = 567 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +1 Query: 337 IPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 IP P P P GPE++P+STP P Sbjct: 14 IPGPEMIPGPEMIPGPEMIPGPETIPKSTPTDP 46 >SB_24489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 376 PLPPSWRGPESLPRSTPVPP 435 P+P + GPE +P+STP P Sbjct: 10 PVPETIPGPEMIPKSTPTDP 29 >SB_21211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +1 Query: 205 RDLRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSP 336 RD+ + L + N K +R+ E + LRG +P++PRSP Sbjct: 11 RDIYKNKIKQLQQEVDNYKKQ--EREREMKALRGGRSPMSPRSP 52 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +1 Query: 322 APRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 438 APR P T T P+PP+ P P + P PP+ Sbjct: 218 APRPPTTQTPPTKAPTDPPVPPT--NPPVPPTNPPAPPT 254 >SB_54131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3160 Score = 28.3 bits (60), Expect = 6.3 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +1 Query: 130 VTPGTPAGRDLVR-GDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVER 291 V G+PA R VR GD I +++ + L H L A + IKL ++ ER Sbjct: 2688 VEDGSPAERAGVRKGDFILQVNGNAVKGLPHFQIVRLIITAASPIKLTLKPGSER 2742 >SB_42720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2391 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 298 LRGSGTPLAPRSPIPNASATPFRTPSPL 381 L + P P SP AS P RTP PL Sbjct: 94 LETTPAPTTPTSPAAPASGPPIRTPIPL 121 >SB_37603| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) Length = 1411 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPL 381 P P SP AS P RTP PL Sbjct: 40 PTTPTSPATPASGAPIRTPIPL 61 >SB_35674| Best HMM Match : SH2 (HMM E-Value=0) Length = 871 Score = 28.3 bits (60), Expect = 6.3 Identities = 19/72 (26%), Positives = 29/72 (40%), Gaps = 2/72 (2%) Frame = +1 Query: 274 QRDVEREGLRGSGTPLAPRSPIPNASAT--PFRTPSPLPPSWRGPESLPRSTPVPPSQFQ 447 +R + + +G G P+P +AT P P P P G ++ PVP + F Sbjct: 423 ERSILSQLTKGDGKHDVATLPVPAGAATVRPNIQPKPTYPPAAGGATISVKPPVPTTWFH 482 Query: 448 PQLDGEYRTYLL 483 + G LL Sbjct: 483 SNVSGHDAERLL 494 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 28.3 bits (60), Expect = 6.3 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 6/45 (13%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRG------PESLPRSTPVPPSQ 441 P P+PN ++ P PLPP+ PE L P PPS+ Sbjct: 299 PAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSE 343 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 28.3 bits (60), Expect = 6.3 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +1 Query: 295 GLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 G+ S P P P P + P P P PP P P P PP Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 343 NASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 N S P P P PPS P P +P PP Q P Sbjct: 362 NMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPP 397 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQ 441 P P + P P P P PP GP P T PPS+ Sbjct: 376 PPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPSE 417 >SB_52290| Best HMM Match : PDZ (HMM E-Value=8.6e-18) Length = 124 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/70 (24%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = +1 Query: 124 RKVTPGTPAGR--DLVRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVEREG 297 +++ PG A L D+I +++ L + +A ++ +N P +++L+++R Sbjct: 36 KRLVPGGSAALCGQLQVNDVILQVNGKSLDRLTYREALSILRNCPPEVRLLVKRS----- 90 Query: 298 LRGSGTPLAP 327 RGS P P Sbjct: 91 -RGSSYPPYP 99 >SB_35964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 337 IPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 IP P P P GPE +P+STP P Sbjct: 2 IPGPEKIPGPEMIPGPEKIPGPEMIPKSTPTDP 34 >SB_19708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1548 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 199 DARDLRHEDAQNLFKNAPNQIKLVIQRDVEREG 297 + +D +ED NL K+ P+Q KL++ D G Sbjct: 1073 ETKDRFYEDLDNLLKSVPDQDKLLLLGDFNAVG 1105 >SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2537 Score = 27.9 bits (59), Expect = 8.3 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 3/62 (4%) Frame = +1 Query: 331 SPIPNASATPFRTPSPLPPSWRGPESLPRS--TPVPPSQFQPQLDGEYRTYLLSPSS-TR 501 S +P ++ F P P RGP + PRS P Q + Y + LSP T+ Sbjct: 774 SRVPVKRSSSFENRKPSPNRRRGPGNEPRSRLNSDPSIQVKDLAPRSYTDFDLSPQKITK 833 Query: 502 TD 507 TD Sbjct: 834 TD 835 >SB_15319| Best HMM Match : Transposase_9 (HMM E-Value=3.2) Length = 782 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPL 381 P P SP AS P RTP PL Sbjct: 70 PTTPTSPATPASGPPIRTPIPL 91 >SB_1728| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 935 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 457 DGEYRTYLLSPSSTRTDETIDES 525 D EY T L+P T+ET++ES Sbjct: 53 DAEYETQSLAPQGVYTEETLNES 75 >SB_47719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 337 IPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 IP P P P GPE +P+STP P Sbjct: 2 IPGPEKIPGPEMIPGPEKIPGPEMIPKSTPTDP 34 >SB_45708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1510 Score = 27.9 bits (59), Expect = 8.3 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 136 ASPFVDQSSWARLQGPRVGVAPAR 65 ++PF+ ++ W RLQ +G+ P R Sbjct: 1035 STPFISENDWPRLQQADLGLPPTR 1058 >SB_40460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 27.9 bits (59), Expect = 8.3 Identities = 33/139 (23%), Positives = 47/139 (33%) Frame = +1 Query: 274 QRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 453 Q D R+ S L +P+P +P P +LPR P+ + Sbjct: 302 QNDEMRKLAAQSPKKLNAPAPLPQGVFATLPSPKSASPP---RHTLPRPEPIGGPVRGSE 358 Query: 454 LDGEYRTYLLSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPA 633 G R P RTD+T +P R P RR P PT H + Sbjct: 359 PKGVARADA-PPVPARTDQT------PRPERPVPAGASPQSRRRRPVPTPRRTVHKTTSS 411 Query: 634 MRAPPNHDYRDTLMKQKVA 690 PN R+ + Q ++ Sbjct: 412 PLLDPNQPLRNRTLPQPLS 430 >SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +1 Query: 160 LVRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQ 276 L RGD + ++ HE A +L K A ++LV++ Sbjct: 576 LKRGDQLLSVNGVSVEGENHEKAVDLLKEAQGSVRLVVK 614 >SB_37987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = +1 Query: 352 ATPFRTPSPLPPSWRGPESLPRSTPV--PPSQFQPQLDGEYRTYLLSPS 492 + P+R P P P ++ P S P + P+ P+Q P + Y PS Sbjct: 203 SVPYRPPMPPPQAYWQPASQPSAPPLMNDPNQAPPYYSQQGSAYPPPPS 251 >SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 406 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 325 PRSPIPNASATPFRTP-SPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYR 471 P +P P+ S P TP + +PP+ S+P TP P + P Y+ Sbjct: 254 PPTPTPHTSIPPTPTPHTSIPPTPTPHTSIP-PTPTPHTSIPPTPHPTYK 302 >SB_29502| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 27.9 bits (59), Expect = 8.3 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = +1 Query: 277 RDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL 456 +D +G + TP+ PI RTP+ P+W+GP+ T + P PQL Sbjct: 300 QDPNSQGPHFARTPIRT-DPISQGPQLA-RTPTRKDPNWQGPQFPRTPTGMDPISKGPQL 357 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRS-TPVPP 435 PL+P +P P P P LPP R P+S TP PP Sbjct: 850 PLSPSAP-PPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPP 889 >SB_25200| Best HMM Match : RVT_1 (HMM E-Value=1.7) Length = 371 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +1 Query: 319 LAPRSPIPNASAT-PFRT-PSPLPPSWRGPESLPRST 423 LAP S P ++AT P R PSPL +W P +L + T Sbjct: 282 LAPASCRPPSNATLPSRERPSPLLEAWNRPATLHKGT 318 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 27.9 bits (59), Expect = 8.3 Identities = 18/50 (36%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = +1 Query: 295 GLRGSGTP--LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 438 G + S +P LAP P A P P LPP P +L P PP+ Sbjct: 167 GQKNSVSPGILAPPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPPT 216 >SB_1163| Best HMM Match : DMA (HMM E-Value=1.4e-11) Length = 403 Score = 27.9 bits (59), Expect = 8.3 Identities = 22/61 (36%), Positives = 26/61 (42%), Gaps = 5/61 (8%) Frame = +1 Query: 316 PLA-PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTP---VPPSQFQ-PQLDGEYRTYL 480 P+A P P S + TPSPLPP +S P P PP P L GE + Sbjct: 311 PIARPLPTSPACSTSRIYTPSPLPPPLLKAKSEPHYRPPVFSPPGACSLPGLTGERSNFS 370 Query: 481 L 483 L Sbjct: 371 L 371 >SB_1049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +1 Query: 331 SPIPNASATPFRTPSPLPPSWRGPESLPRS--TPVPPS 438 SPI + ++ P P P P R P S+P S P PPS Sbjct: 43 SPITSVASKPSLVPHP--PQMRKPVSVPSSPKKPTPPS 78 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.317 0.136 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,359,260 Number of Sequences: 59808 Number of extensions: 624630 Number of successful extensions: 3135 Number of sequences better than 10.0: 150 Number of HSP's better than 10.0 without gapping: 2299 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2950 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -