BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30836 (695 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g50580.1 68416.m05532 proline-rich family protein contains pr... 40 0.001 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 36 0.034 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 35 0.045 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 35 0.045 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 35 0.059 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 35 0.059 At2g43680.2 68415.m05430 calmodulin-binding family protein simil... 34 0.078 At2g43680.1 68415.m05429 calmodulin-binding family protein simil... 34 0.078 At2g23130.2 68415.m02759 arabinogalactan-protein (AGP17) identic... 34 0.078 At2g23130.1 68415.m02760 arabinogalactan-protein (AGP17) identic... 34 0.078 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 34 0.078 At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identic... 34 0.10 At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetica... 34 0.10 At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetica... 34 0.10 At1g62970.1 68414.m07110 DNAJ heat shock N-terminal domain-conta... 34 0.10 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 34 0.10 At5g61090.1 68418.m07665 proline-rich family protein contains pr... 33 0.14 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 33 0.14 At3g24550.1 68416.m03083 protein kinase family protein contains ... 33 0.14 At1g26150.1 68414.m03192 protein kinase family protein similar t... 33 0.14 At5g53870.1 68418.m06701 plastocyanin-like domain-containing pro... 33 0.18 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 33 0.18 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 33 0.24 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 33 0.24 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 32 0.32 At4g21670.1 68417.m03139 double-stranded RNA-binding domain (DsR... 32 0.32 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 32 0.32 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 32 0.32 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 32 0.32 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 32 0.42 At5g38560.1 68418.m04662 protein kinase family protein contains ... 31 0.55 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 31 0.55 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 31 0.55 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 31 0.55 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 31 0.73 At1g23540.1 68414.m02960 protein kinase family protein contains ... 31 0.73 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 31 0.96 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 31 0.96 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 31 0.96 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 31 0.96 At1g13050.1 68414.m01513 expressed protein 31 0.96 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 30 1.3 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 30 1.3 At3g25500.1 68416.m03171 formin homology 2 domain-containing pro... 30 1.3 At2g18470.1 68415.m02151 protein kinase family protein contains ... 30 1.3 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 30 1.3 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 30 1.3 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 30 1.7 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 30 1.7 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 30 1.7 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 30 1.7 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 30 1.7 At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein si... 30 1.7 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 30 1.7 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 30 1.7 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 30 1.7 At4g11260.1 68417.m01822 phosphatase-related low similarity to p... 30 1.7 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 30 1.7 At3g10070.1 68416.m01207 transcription initiation factor IID (TF... 30 1.7 At5g55020.1 68418.m06853 myb family transcription factor (MYB120... 29 2.2 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 29 2.2 At3g46620.1 68416.m05061 zinc finger (C3HC4-type RING finger) fa... 29 2.2 At2g45470.1 68415.m05655 fasciclin-like arabinogalactan-protein ... 29 2.2 At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t... 29 2.2 At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t... 29 2.2 At2g27100.1 68415.m03256 C2H2 zinc-finger protein SERRATE (SE) i... 29 2.2 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 29 2.2 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 29 2.2 At1g53645.1 68414.m06102 hydroxyproline-rich glycoprotein family... 29 2.2 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 29 2.2 At1g08060.2 68414.m00881 MOM1 identical to MOM1 (mutation in a '... 29 2.2 At1g08060.1 68414.m00880 MOM1 identical to MOM1 (mutation in a '... 29 2.2 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 29 2.9 At3g32904.1 68416.m04164 hypothetical protein 29 2.9 At3g07130.1 68416.m00849 serine/threonine protein phosphatase fa... 29 2.9 At3g02670.1 68416.m00258 proline-rich family protein contains pr... 29 2.9 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 29 2.9 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 29 2.9 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 29 2.9 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 29 2.9 At1g10620.1 68414.m01204 protein kinase family protein contains ... 29 2.9 At5g26070.1 68418.m03102 hydroxyproline-rich glycoprotein family... 29 3.9 At4g01810.1 68417.m00238 protein transport protein-related relat... 29 3.9 At3g57380.1 68416.m06387 expressed protein contains Pfam domain,... 29 3.9 At3g24860.1 68416.m03118 hydroxyproline-rich glycoprotein family... 29 3.9 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 29 3.9 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 29 3.9 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 29 3.9 At1g75340.1 68414.m08751 zinc finger (CCCH-type) family protein ... 29 3.9 At1g61080.1 68414.m06877 proline-rich family protein 29 3.9 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 29 3.9 At1g49270.1 68414.m05524 protein kinase family protein contains ... 29 3.9 At1g49190.1 68414.m05515 two-component responsive regulator fami... 29 3.9 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 29 3.9 At5g56980.1 68418.m07112 expressed protein non-consensus CG dono... 28 5.1 At5g56890.1 68418.m07099 protein kinase family protein contains ... 28 5.1 At5g21160.1 68418.m02528 La domain-containing protein / proline-... 28 5.1 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 28 5.1 At3g16770.1 68416.m02141 AP2 domain-containing protein RAP2.3 (R... 28 5.1 At2g41870.1 68415.m05177 remorin family protein contains Pfam do... 28 5.1 At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc... 28 5.1 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 28 5.1 At1g78310.1 68414.m09126 VQ motif-containing protein contains PF... 28 5.1 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 28 5.1 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 28 5.1 At1g03780.1 68414.m00359 targeting protein-related similar to mi... 28 5.1 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 28 5.1 At4g36080.1 68417.m05136 FAT domain-containing protein / phospha... 28 6.8 At3g18810.1 68416.m02389 protein kinase family protein contains ... 28 6.8 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 28 6.8 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 28 6.8 At5g55310.1 68418.m06893 DNA topoisomerase I, putative similar t... 27 9.0 At5g52680.1 68418.m06540 heavy-metal-associated domain-containin... 27 9.0 At5g16100.1 68418.m01881 hypothetical protein 27 9.0 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 27 9.0 At5g11510.1 68418.m01343 myb family transcription factor (MYB3R4... 27 9.0 At5g01040.1 68418.m00007 laccase family protein / diphenol oxida... 27 9.0 At4g19570.1 68417.m02877 DNAJ heat shock N-terminal domain-conta... 27 9.0 At4g18760.1 68417.m02772 leucine-rich repeat family protein cont... 27 9.0 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 27 9.0 At4g14990.1 68417.m02303 expressed protein 27 9.0 At3g44200.1 68416.m04739 protein kinase family protein contains ... 27 9.0 At3g24540.1 68416.m03082 protein kinase family protein contains ... 27 9.0 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 27 9.0 At2g40760.1 68415.m05028 rhodanese-like domain-containing protei... 27 9.0 At2g17930.1 68415.m02076 FAT domain-containing protein / phospha... 27 9.0 At1g63570.1 68414.m07186 receptor-like protein kinase-related co... 27 9.0 At1g14920.1 68414.m01783 gibberellin response modulator (GAI) (R... 27 9.0 At1g12970.1 68414.m01506 leucine-rich repeat family protein 27 9.0 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 40.3 bits (90), Expect = 0.001 Identities = 34/112 (30%), Positives = 53/112 (47%) Frame = +1 Query: 319 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSST 498 ++P +PIP+ +TP +P P P P P+ +P PPS P + + T SPS Sbjct: 75 ISPSTPIPSTPSTP--SPPPPAPKKSPPPPTPKKSPSPPS-LTPFV--PHPTPKKSPSPP 129 Query: 499 RTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNH 654 T + + P +TP LP ++ P P S+ H +P+ PP+H Sbjct: 130 PTPSLPPPAPKKSP--STP-SLPPPTPKKSPPPPPSH--HSSSPS--NPPHH 174 Score = 30.7 bits (66), Expect = 0.96 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 TP P P P S +P TPS PP+ + S P P P + P Sbjct: 114 TPFVPH-PTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPP 158 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 35.5 bits (78), Expect = 0.034 Identities = 21/50 (42%), Positives = 24/50 (48%) Frame = +1 Query: 307 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL 456 S P A P P A+ P P PLPP P S P++TP PP P L Sbjct: 123 SPPPPAITPPPPLATTPPALPPKPLPP----PLSPPQTTPPPPPAITPPL 168 Score = 34.7 bits (76), Expect = 0.059 Identities = 19/45 (42%), Positives = 22/45 (48%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 P SP P A+ P P PLPP P S P++TP PP P Sbjct: 72 PPQSTSPPPVATTPPALPPKPLPP----PLSPPQTTPPPPPAITP 112 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 355 TPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL 456 +P +P PLPP P P++TP PP P L Sbjct: 257 SPTISPPPLPPQTLKPPP-PQTTPPPPPAITPPL 289 Score = 29.1 bits (62), Expect = 2.9 Identities = 32/111 (28%), Positives = 39/111 (35%), Gaps = 3/111 (2%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP-SQFQPQLDGEYRTYLLSPSSTR 501 P P P P T P PP+ P P+ST PP + P L + LSP T Sbjct: 46 PPQPDPQPPTPP--TFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTT 103 Query: 502 TDETIDESIQSQPYRTTPLVLPGAKVRREP--GPTESYLRHHPNPAMRAPP 648 + P T PL P + P T L P P +PP Sbjct: 104 PPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPP 154 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 35.1 bits (77), Expect = 0.045 Identities = 29/97 (29%), Positives = 41/97 (42%) Frame = +1 Query: 322 APRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTR 501 +P SP ++S+T +P+P P P P STP PP +F P T +P Sbjct: 84 SPPSPTDSSSSTSI-SPNP-PAPIVNPNPPPPSTPNPPPEFSPPPPDLDTT--TAPPPPS 139 Query: 502 TDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYL 612 TD I P +P + P + V P P + L Sbjct: 140 TDIPIPPP-PPAPVSASPPLTPPSSVVTSPAPVHAKL 175 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +1 Query: 307 SGTPLAPRSPIP--NASATPFRTPSPLPPSWRGPESLPRST-PVPPS 438 S T ++P P P N + P TP+P P P L +T P PPS Sbjct: 93 SSTSISPNPPAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPS 139 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 35.1 bits (77), Expect = 0.045 Identities = 30/118 (25%), Positives = 50/118 (42%), Gaps = 1/118 (0%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQ-FQPQLDGEYRTYLLSPS 492 P P +P+P A++ P+P S G S P P P S+ + D + S Sbjct: 819 PPKPVTPLPPATSPMANAPTP-SSSESGEISTPVQAPTPDSEDIEAPSDSNHSPVFKSSP 877 Query: 493 STRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDYRD 666 + D + +++ + P V A + E P+ S +P+P + APP+ D D Sbjct: 878 APSPDS--EPEVEAPVPSSEPEV--EAPKQSEATPSSSPPSSNPSPDVTAPPSEDNDD 931 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = +1 Query: 313 TPLAPRSPIPNA----SATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 TP SP P + P +P P PP P+ P PP Q QP Sbjct: 543 TPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQEQP 592 Score = 28.7 bits (61), Expect = 3.9 Identities = 27/120 (22%), Positives = 42/120 (35%), Gaps = 2/120 (1%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS 495 P SP P P +P P PP P+ P PP Q P+ + + + Sbjct: 517 PKPEESPKPEPPK-PEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQET 575 Query: 496 TRTDET--IDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDYRDT 669 + +E+ Q QP +T + G+ P P + Y PP+ +T Sbjct: 576 PKPEESPKPQPPKQEQPPKTEAPKM-GSPPLESPVPNDPYDASPIKKRRPQPPSPSTEET 634 Score = 27.9 bits (59), Expect = 6.8 Identities = 26/123 (21%), Positives = 43/123 (34%), Gaps = 7/123 (5%) Frame = +1 Query: 307 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTY--- 477 S P P+ P P +P P PP P+ P PP Q P+ + + Sbjct: 533 SPKPQPPKQETPK----PEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPK 588 Query: 478 LLSPSSTRTDE----TIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAP 645 P T + ++ + + PY +P+ +R P P + ++P Sbjct: 589 QEQPPKTEAPKMGSPPLESPVPNDPYDASPI------KKRRPQPPSPSTEETKTTSPQSP 642 Query: 646 PNH 654 P H Sbjct: 643 PVH 645 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 34.7 bits (76), Expect = 0.059 Identities = 30/113 (26%), Positives = 37/113 (32%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS 495 P P P P + P +P P PP P P P PP + P Y + PS Sbjct: 469 PPPPPPPPPPVYSPPPPSPPPPPPPVYSPPP-PPPPPPPPPVYSPPPPPVYSSPPPPPSP 527 Query: 496 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNH 654 T P+ P + P P E Y P P +PP H Sbjct: 528 APTPVYCTRPPPPPPHSPPP-------PQFSPPPPEPYYYSSPPPPHSSPPPH 573 Score = 31.1 bits (67), Expect = 0.73 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 2/72 (2%) Frame = +1 Query: 241 KNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPS--WRGPESLP 414 + +P Q K + R G G ++PR P+ P PSP PP+ + P +L Sbjct: 366 QRSPGQCKAFLSRPPVNCGSFSCGRSVSPRPPVVTPLPPP-SLPSPPPPAPIFSTPPTL- 423 Query: 415 RSTPVPPSQFQP 450 ++P PPS P Sbjct: 424 -TSPPPPSPPPP 434 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/46 (32%), Positives = 18/46 (39%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 +P P P P + P P P PP P P P PP + P Sbjct: 437 SPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSP 482 Score = 29.5 bits (63), Expect = 2.2 Identities = 23/52 (44%), Positives = 24/52 (46%), Gaps = 6/52 (11%) Frame = +1 Query: 313 TPLAPRS-PIPNASATPFRTP----SPLPPSWRGPE-SLPRSTPVPPSQFQP 450 TPL P S P P A F TP SP PPS P S P P PP + P Sbjct: 400 TPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSP 451 Score = 29.1 bits (62), Expect = 2.9 Identities = 28/111 (25%), Positives = 32/111 (28%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS 495 P P P P S P P P PP + P P P PP P + Sbjct: 439 PPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPP 498 Query: 496 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 648 + S P P V P PT Y P P +PP Sbjct: 499 PPPPPPPPPPVYSPP---PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPP 546 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLP--RSTPVPP 435 +P P +P+ + TP +P P PP P P +P PP Sbjct: 590 SPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPP 632 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 34.7 bits (76), Expect = 0.059 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 316 PLAPRS-PIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 P AP+ P P+ P TP P+PP P+ P TP P + P Sbjct: 90 PPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAP 135 Score = 30.3 bits (65), Expect = 1.3 Identities = 30/117 (25%), Positives = 40/117 (34%), Gaps = 4/117 (3%) Frame = +1 Query: 307 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRST----PVPPSQFQPQLDGEYRT 474 S P+AP P A P +P P PP P+ P + P PP + QP+ Sbjct: 9 SPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPAC 68 Query: 475 YLLSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAP 645 P E + P P+ P + P PT + H P AP Sbjct: 69 PPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPP--KPPAPTPKPVPPHGPPPKPAP 123 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 P P+ P P P P P P P P+ P PP Sbjct: 99 PSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPP 138 >At2g43680.2 68415.m05430 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 669 Score = 34.3 bits (75), Expect = 0.078 Identities = 36/111 (32%), Positives = 49/111 (44%), Gaps = 1/111 (0%) Frame = +1 Query: 319 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRS-TPVPPSQFQPQLDGEYRTYLLSPSS 495 L+P+ P P A R+ SP PPS R LPRS +P P + +P L P+S Sbjct: 127 LSPKPPSPRAEVP--RSLSPKPPSPRA--DLPRSLSPKPFDRSKPSSASANAPPTLRPAS 182 Query: 496 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 648 TR + SQ R TP +P + G + + P P+ RA P Sbjct: 183 TR--------VPSQ--RITPHSVPSPRPSSPRGASPQAISSKP-PSPRAEP 222 Score = 32.3 bits (70), Expect = 0.32 Identities = 35/114 (30%), Positives = 48/114 (42%), Gaps = 5/114 (4%) Frame = +1 Query: 319 LAPRSP-IPNASATPFRTPSPLPPSWRG--PESLPRSTPVPPSQFQPQLDGEYRTYLLSP 489 L P S +P+ TP PSP P S RG P+++ P P ++ P LD R Sbjct: 178 LRPASTRVPSQRITPHSVPSPRPSSPRGASPQAISSKPPSPRAE-PPTLDTP-RPPSPRA 235 Query: 490 SSTRTD-ETIDESIQSQPYRTTPLV-LPGAKVRREPGPTESYLRHHPNPAMRAP 645 +S R D +D + + P +PL P R P R P P + AP Sbjct: 236 ASLRADPPRLDAARPTTPRPPSPLADAPRLDAPRPTTPKPPSPRSDP-PRLDAP 288 Score = 28.7 bits (61), Expect = 3.9 Identities = 22/48 (45%), Positives = 24/48 (50%), Gaps = 7/48 (14%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTP---SPLPPSWRG-PESL--PR-STPVPPS 438 P PR P P A A P +P PPS R P L PR +TP PPS Sbjct: 250 PTTPRPPSPLADAPRLDAPRPTTPKPPSPRSDPPRLDAPRPTTPKPPS 297 >At2g43680.1 68415.m05429 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 668 Score = 34.3 bits (75), Expect = 0.078 Identities = 36/111 (32%), Positives = 49/111 (44%), Gaps = 1/111 (0%) Frame = +1 Query: 319 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRS-TPVPPSQFQPQLDGEYRTYLLSPSS 495 L+P+ P P A R+ SP PPS R LPRS +P P + +P L P+S Sbjct: 126 LSPKPPSPRAEVP--RSLSPKPPSPRA--DLPRSLSPKPFDRSKPSSASANAPPTLRPAS 181 Query: 496 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 648 TR + SQ R TP +P + G + + P P+ RA P Sbjct: 182 TR--------VPSQ--RITPHSVPSPRPSSPRGASPQAISSKP-PSPRAEP 221 Score = 32.3 bits (70), Expect = 0.32 Identities = 35/114 (30%), Positives = 48/114 (42%), Gaps = 5/114 (4%) Frame = +1 Query: 319 LAPRSP-IPNASATPFRTPSPLPPSWRG--PESLPRSTPVPPSQFQPQLDGEYRTYLLSP 489 L P S +P+ TP PSP P S RG P+++ P P ++ P LD R Sbjct: 177 LRPASTRVPSQRITPHSVPSPRPSSPRGASPQAISSKPPSPRAE-PPTLDTP-RPPSPRA 234 Query: 490 SSTRTD-ETIDESIQSQPYRTTPLV-LPGAKVRREPGPTESYLRHHPNPAMRAP 645 +S R D +D + + P +PL P R P R P P + AP Sbjct: 235 ASLRADPPRLDAARPTTPRPPSPLADAPRLDAPRPTTPKPPSPRSDP-PRLDAP 287 Score = 28.7 bits (61), Expect = 3.9 Identities = 22/48 (45%), Positives = 24/48 (50%), Gaps = 7/48 (14%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTP---SPLPPSWRG-PESL--PR-STPVPPS 438 P PR P P A A P +P PPS R P L PR +TP PPS Sbjct: 249 PTTPRPPSPLADAPRLDAPRPTTPKPPSPRSDPPRLDAPRPTTPKPPS 296 >At2g23130.2 68415.m02759 arabinogalactan-protein (AGP17) identical to gi_11935086_gb_AAG41963 Length = 162 Score = 34.3 bits (75), Expect = 0.078 Identities = 20/94 (21%), Positives = 38/94 (40%), Gaps = 1/94 (1%) Frame = +1 Query: 319 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTP-VPPSQFQPQLDGEYRTYLLSPSS 495 ++P +P P ++ P +TP P P P STP + P P+ D + + Sbjct: 46 ISPAAPTPESTEAPAKTPVEAPVE-APPSPTPASTPQISPPAPSPEADTPSAPEIAPSAD 104 Query: 496 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGP 597 +++ ++T P P +++ P P Sbjct: 105 VPAPALTKHKKKTKKHKTAPAPGPASELLSPPAP 138 >At2g23130.1 68415.m02760 arabinogalactan-protein (AGP17) identical to gi_11935086_gb_AAG41963 Length = 185 Score = 34.3 bits (75), Expect = 0.078 Identities = 20/94 (21%), Positives = 38/94 (40%), Gaps = 1/94 (1%) Frame = +1 Query: 319 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTP-VPPSQFQPQLDGEYRTYLLSPSS 495 ++P +P P ++ P +TP P P P STP + P P+ D + + Sbjct: 46 ISPAAPTPESTEAPAKTPVEAPVE-APPSPTPASTPQISPPAPSPEADTPSAPEIAPSAD 104 Query: 496 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGP 597 +++ ++T P P +++ P P Sbjct: 105 VPAPALTKHKKKTKKHKTAPAPGPASELLSPPAP 138 >At1g63550.1 68414.m07184 hypothetical protein low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 299 Score = 34.3 bits (75), Expect = 0.078 Identities = 20/40 (50%), Positives = 23/40 (57%) Frame = +1 Query: 331 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 SP P+ SA P R+P PP P SLP+ TP PP F P Sbjct: 225 SPPPSPSAPPPRSP---PPKSSPPSSLPQ-TPSPPLVFTP 260 >At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identical to gi|10880497|gb|AAG24278; supported by Ceres cDNA 265772 Length = 127 Score = 33.9 bits (74), Expect = 0.10 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 PR+ P S TP TP+P P S P +P+P S P Sbjct: 40 PRTAAPTPSITPTPTPTPSATPTAAPVSPPAGSPLPSSASPP 81 Score = 31.9 bits (69), Expect = 0.42 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 TP +P P SATP T +P+ P P S P PP+ P Sbjct: 46 TPSITPTPTPTPSATP--TAAPVSPPAGSPLPSSASPPAPPTSLTP 89 >At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1102 Score = 33.9 bits (74), Expect = 0.10 Identities = 28/104 (26%), Positives = 38/104 (36%), Gaps = 4/104 (3%) Frame = +1 Query: 337 IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETI 516 +P S P + P+ P P P TP P S QP + + P+ D+ Sbjct: 832 VPQVSHPPMQQPTMFMPHQAQPAPQPSFTPAPTSNAQPSMRTTF-VPSTPPALKNADQYQ 890 Query: 517 DESIQSQ----PYRTTPLVLPGAKVRREPGPTESYLRHHPNPAM 636 ++ S P V PG GP S L +PNP M Sbjct: 891 QPTMSSHSFTGPSNNAYPVPPGPGQYAPSGP--SQLGQYPNPKM 932 Score = 28.3 bits (60), Expect = 5.1 Identities = 28/119 (23%), Positives = 43/119 (36%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPS 492 T P +P +A ++ P+ S+ GP + P P Q+ P + Y +P Sbjct: 873 TTFVPSTPPALKNADQYQQPTMSSHSFTGPSNNAYPVPPGPGQYAPSGPSQLGQY-PNPK 931 Query: 493 STRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDYRDT 669 + I P TP V P + P ++ + P PA PP DT Sbjct: 932 MPQVVAPAAGPIGFTP-MATPGVAPRSVQPASPPTQQAAAQAAPAPA-TPPPTVQTADT 988 >At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1104 Score = 33.9 bits (74), Expect = 0.10 Identities = 28/104 (26%), Positives = 38/104 (36%), Gaps = 4/104 (3%) Frame = +1 Query: 337 IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETI 516 +P S P + P+ P P P TP P S QP + + P+ D+ Sbjct: 834 VPQVSHPPMQQPTMFMPHQAQPAPQPSFTPAPTSNAQPSMRTTF-VPSTPPALKNADQYQ 892 Query: 517 DESIQSQ----PYRTTPLVLPGAKVRREPGPTESYLRHHPNPAM 636 ++ S P V PG GP S L +PNP M Sbjct: 893 QPTMSSHSFTGPSNNAYPVPPGPGQYAPSGP--SQLGQYPNPKM 934 Score = 28.3 bits (60), Expect = 5.1 Identities = 28/119 (23%), Positives = 43/119 (36%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPS 492 T P +P +A ++ P+ S+ GP + P P Q+ P + Y +P Sbjct: 875 TTFVPSTPPALKNADQYQQPTMSSHSFTGPSNNAYPVPPGPGQYAPSGPSQLGQY-PNPK 933 Query: 493 STRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDYRDT 669 + I P TP V P + P ++ + P PA PP DT Sbjct: 934 MPQVVAPAAGPIGFTP-MATPGVAPRSVQPASPPTQQAAAQAAPAPA-TPPPTVQTADT 990 >At1g62970.1 68414.m07110 DNAJ heat shock N-terminal domain-containing protein low similarity to AHM1 [Triticum aestivum] GI:6691467; contains Pfam profile PF00226: DnaJ domain Length = 797 Score = 33.9 bits (74), Expect = 0.10 Identities = 33/115 (28%), Positives = 39/115 (33%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRT 504 P + P S P T P+P S S P PP FQ + S S Sbjct: 519 PTTSKPFVSQPP-NTSKPMPVSQPPTTSKPLPVSQPPPTFQSTCPSQPPAASSSLSPLPP 577 Query: 505 DETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDYRDT 669 +S QS P TTP +P A P P PA A P H + T Sbjct: 578 VFNSTQSFQSPPVSTTPSAVPEASTIPSP----------PAPAPVAQPTHVFNQT 622 Score = 29.5 bits (63), Expect = 2.2 Identities = 26/103 (25%), Positives = 40/103 (38%) Frame = +1 Query: 340 PNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETID 519 P++++ PF P P S P S PR P S QP P+++++ Sbjct: 458 PSSNSKPFPVSQPQPASNPFPVSQPRPNSQPFSMSQPSSTARPFPASQPPAASKSFPISQ 517 Query: 520 ESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 648 S+P+ + P +P PT S P P + PP Sbjct: 518 PPTTSKPFVSQPPNTSKPMPVSQP-PTTS----KPLPVSQPPP 555 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 33.9 bits (74), Expect = 0.10 Identities = 36/117 (30%), Positives = 44/117 (37%), Gaps = 3/117 (2%) Frame = +1 Query: 319 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSST 498 + P P P+ P TPSP PPS P P TP PP P Y SP Sbjct: 608 VTPSPPPPSPLYYPPVTPSPPPPS---PVYYPPVTPSPP----PPSPVYYPPVTPSPPPP 660 Query: 499 RTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHP---NPAMRAPPNHDY 660 E+ QS P T P + P PT++ HP P+ PP + Y Sbjct: 661 SPVYYPSET-QSPPPPTEYYYSPS----QSPPPTKACKEGHPPQATPSYEPPPEYSY 712 Score = 32.3 bits (70), Expect = 0.32 Identities = 18/40 (45%), Positives = 20/40 (50%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 P+ P P P+ P TPSP PPS P P TP PP Sbjct: 622 PVTPSPPPPSPVYYPPVTPSPPPPS---PVYYPPVTPSPP 658 Score = 31.9 bits (69), Expect = 0.42 Identities = 32/111 (28%), Positives = 44/111 (39%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS 495 P+ P P+ P TPSP PPS P P TP PP P Y ++PS Sbjct: 592 PVTYSPPPPSPVYYPQVTPSPPPPS---PLYYPPVTPSPP----PPSPVYYPP--VTPSP 642 Query: 496 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 648 + P +P+ P ++ + P PTE Y +P+ PP Sbjct: 643 PPPSPVYYPPVTPSPPPPSPVYYP-SETQSPPPPTEYYY----SPSQSPPP 688 >At5g61090.1 68418.m07665 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; common family members: At4g18570, At3g25690, At4g04980 [Arabidopsis thaliana] Length = 344 Score = 33.5 bits (73), Expect = 0.14 Identities = 32/132 (24%), Positives = 55/132 (41%), Gaps = 1/132 (0%) Frame = +1 Query: 253 NQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 432 +++KL+ + + G+G ++P P A AT + P +PPS R PE+ PRS P Sbjct: 57 SKVKLLSPEEAMKLTSGGNGVAVSPVKP---ARATS-QVPKRVPPS-RTPEA-PRSVPAC 110 Query: 433 PSQFQPQ-LDGEYRTYLLSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESY 609 P P+ + P + R I + ++P ++P P P + Sbjct: 111 PIPEIPRPVPARPTPETPRPVTARPTPEIPRPVPARPISEVQTLVPTRPTSTAPSPVSA- 169 Query: 610 LRHHPNPAMRAP 645 HP + +P Sbjct: 170 ---HPTSVVPSP 178 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 33.5 bits (73), Expect = 0.14 Identities = 27/88 (30%), Positives = 38/88 (43%), Gaps = 2/88 (2%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSP--LPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSP 489 P+ +P P+ ++P TPS PPS S P S P PPS P L SP Sbjct: 117 PVLAAAPSPSTPSSPPSTPSTPSSPPSTPSTPSSPPSPPSPPS---PSLPPSSLPPSASP 173 Query: 490 SSTRTDETIDESIQSQPYRTTPLVLPGA 573 + T ++ E++ P P + P A Sbjct: 174 PTNGTPDS--ETLTPPPAPLPPSLSPNA 199 Score = 31.1 bits (67), Expect = 0.73 Identities = 22/48 (45%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSP-LPPSWR-GPESLPRSTPVPPSQFQP 450 TP P SP P+ +TP PSP PPS P SLP S PP+ P Sbjct: 134 TPSTPSSP-PSTPSTPSSPPSPPSPPSPSLPPSSLPPSAS-PPTNGTP 179 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 33.5 bits (73), Expect = 0.14 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPR-STPVPPSQFQP 450 +P AP +P P + TP SP P+ +GP + P STP PS +P Sbjct: 81 SPSAPITPSPPSPTTPSNPRSPPSPN-QGPPNTPSGSTPRTPSNTKP 126 Score = 31.9 bits (69), Expect = 0.42 Identities = 23/56 (41%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +1 Query: 331 SPIPNASATP-FRTPSPLPPS-WRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPS 492 +P P AS+ P TPS PPS S P S+P+PPS P G L PS Sbjct: 26 TPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPS 81 Score = 30.3 bits (65), Expect = 1.3 Identities = 26/69 (37%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = +1 Query: 304 GSGTPLAPRSPIPNASATPFRTPSPLPPS-WRGPESLPRSTPVPPSQFQPQLDGEYRTYL 480 GS TP P+ P P+A TP PSP PS R P S + P PS P+ + Sbjct: 71 GSLTPPLPQ-PSPSAPITP-SPPSPTTPSNPRSPPSPNQGPPNTPSGSTPRTPSNTKP-- 126 Query: 481 LSPSSTRTD 507 SP S +D Sbjct: 127 -SPPSDSSD 134 Score = 29.5 bits (63), Expect = 2.2 Identities = 28/103 (27%), Positives = 38/103 (36%) Frame = +1 Query: 343 NASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETIDE 522 + + +P TPSP PPS P + +TP P + P T P S T+ T Sbjct: 2 STAPSPGTTPSPSPPS--PPTNSTTTTPPPAASSPPPT----TTPSSPPPSPSTNSTSPP 55 Query: 523 SIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPN 651 P P PG+ P P+ S P+ P N Sbjct: 56 PSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSN 98 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 33.5 bits (73), Expect = 0.14 Identities = 37/119 (31%), Positives = 44/119 (36%), Gaps = 2/119 (1%) Frame = +1 Query: 298 LRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTY 477 L G P SP P S P PP+ P S+P PP P + T Sbjct: 82 LTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPP----PPTEAPPTTP 137 Query: 478 LLSPSSTRTDETIDESIQSQPYRTTPL-VLPGAKVRREPGPTESYLRHHPN-PAMRAPP 648 + SPS ES S P P LP K+ P+ S RH P+ PA PP Sbjct: 138 ITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKL---VPPSHSPPRHLPSPPASEIPP 193 Score = 31.5 bits (68), Expect = 0.55 Identities = 30/116 (25%), Positives = 41/116 (35%), Gaps = 2/116 (1%) Frame = +1 Query: 307 SGTPLAPRSPIPNASATPFRTPSPLPPSWRG--PESLPRSTPVPPSQFQPQLDGEYRTYL 480 + TP P ++P PSP PS G P ++P S P PS P L E Sbjct: 54 TNTPAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSP-PPPLPTEAPPPA 112 Query: 481 LSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 648 SS + + ++ TTP+ P P P P+P P Sbjct: 113 NPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLP 168 Score = 30.7 bits (66), Expect = 0.96 Identities = 33/123 (26%), Positives = 43/123 (34%), Gaps = 7/123 (5%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDG--EYRTYLLSP 489 P P S P S+ P P+ PP+ P + P PP + P L L P Sbjct: 111 PANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPP 170 Query: 490 SSTRTDETIDESIQSQPYRTTP-----LVLPGAKVRREPGPTESYLRHHPNPAMRAPPNH 654 + + S P P L P A R P++S HP+P PP H Sbjct: 171 KLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDS---EHPSP---PPPGH 224 Query: 655 DYR 663 R Sbjct: 225 PKR 227 Score = 29.9 bits (64), Expect = 1.7 Identities = 27/110 (24%), Positives = 40/110 (36%) Frame = +1 Query: 322 APRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTR 501 AP P +S P +P P PP+ P + P ++P PP+ P + P+ Sbjct: 108 APPPANPVSSPPPESSPPPPPPT-EAPPTTPITSPSPPTNPPPPPESPPSL----PAPDP 162 Query: 502 TDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPN 651 + P + P LP P P RH P+P P+ Sbjct: 163 PSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPP----RHLPSPPASERPS 208 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/49 (32%), Positives = 19/49 (38%) Frame = +1 Query: 304 GSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 GS P P P P+ S P P PP P P P+P + P Sbjct: 235 GSKRP-TPSPPSPSDSKRPVHPSPPSPPEETLPPPKPSPDPLPSNSSSP 282 >At5g53870.1 68418.m06701 plastocyanin-like domain-containing protein contains similarity to SP|Q02917 Early nodulin 55-2 precursor {Glycine max}; PF02298: Plastocyanin-like domain Length = 370 Score = 33.1 bits (72), Expect = 0.18 Identities = 30/119 (25%), Positives = 48/119 (40%) Frame = +3 Query: 315 ATSATFAHTQRKRHTIQDSKPVASVMAWSGISASQHTGATFAIPATTGRRIQNLSAVAFF 494 A ++ + +Q R ++ ++P S S A + AT PAT ++ S V+ Sbjct: 161 APASAPSKSQPPRSSVSPAQPPKSSSPISHTPALSPSHATSHSPATPSPSPKSPSPVSHS 220 Query: 495 HAHR*DHR*VYSESAVPHHSSRAPGS*GPKGAWPHRELPASSPQPSNEGTS*PRLP*YP 671 +H H +S + P HS S P A H A S P++ + P P P Sbjct: 221 PSHSPAHTPSHSPAHTPSHSPAHAPSHSPAHAPSHSPAHAPSHSPAHSPSHSPATPKSP 279 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 33.1 bits (72), Expect = 0.18 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 7/56 (12%) Frame = +1 Query: 310 GTPLAPRSPIPN----ASATPFRTPSPLPPSWRGPESLPR---STPVPPSQFQPQL 456 G+P +P SP P+ + TP P+P+ P P +P + P PPS P L Sbjct: 544 GSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPL 599 Score = 32.3 bits (70), Expect = 0.32 Identities = 38/117 (32%), Positives = 48/117 (41%), Gaps = 5/117 (4%) Frame = +1 Query: 310 GTPLAPR-SPIPNASA-TPFRTPSP--LPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTY 477 G+P +P SP P + +P TPSP PPS S P +TP P S P T Sbjct: 421 GSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGS---PPTSPTTPTP 477 Query: 478 LLSPSSTRTDETIDESIQSQPYRTTP-LVLPGAKVRREPGPTESYLRHHPNPAMRAP 645 SP S+ T T S S P TP P + PG + P+P + P Sbjct: 478 GGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVP 534 Score = 31.9 bits (69), Expect = 0.42 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 304 GSGTPLAPRSPIPNASA-TPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 G P +P +P P S +P +PSP P + P S P S PPS P Sbjct: 504 GGSPPSSPTTPSPGGSPPSPSISPSP-PITVPSPPSTPTSPGSPPSPSSP 552 Score = 28.7 bits (61), Expect = 3.9 Identities = 31/112 (27%), Positives = 41/112 (36%), Gaps = 1/112 (0%) Frame = +1 Query: 322 APRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTR 501 +P +P+ +TP SP PS P S S P P + P G+ SP Sbjct: 528 SPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQN-----SPPIIP 582 Query: 502 TDETIDESIQSQPYRTTPLVLPGAKVRREPGPT-ESYLRHHPNPAMRAPPNH 654 + S S P P V+P + GPT S P P P+H Sbjct: 583 SPPFTGPSPPSSPSPPLPPVIPSPPI---VGPTPSSPPPSTPTPGTLLHPHH 631 Score = 28.3 bits (60), Expect = 5.1 Identities = 21/68 (30%), Positives = 28/68 (41%) Frame = +1 Query: 295 GLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRT 474 G G G P +P+ TP +P PPS S P + P PP+ P + Sbjct: 396 GSFGCGRSTRPPVVVPSPPTTP--SPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPS 453 Query: 475 YLLSPSST 498 + SP ST Sbjct: 454 IVPSPPST 461 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 319 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 438 + P P P+ + P TP+P PS P + + P PPS Sbjct: 198 VTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPS 237 Score = 31.1 bits (67), Expect = 0.73 Identities = 33/113 (29%), Positives = 40/113 (35%), Gaps = 2/113 (1%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRST-PVPPSQFQPQLDGEYRTYLLS-P 489 P+ P SP P + P TP PP S+P T PV P P T +S P Sbjct: 77 PVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 136 Query: 490 SSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 648 T T + P TP P P PT+ + P P PP Sbjct: 137 PPTPTPSVPSPTPPVSPPPPTP--TPSVPSPTPPVPTDP-MPSPPPPVSPPPP 186 Score = 30.7 bits (66), Expect = 0.96 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 P +P P+ + P TP+P PS P P TP PP+ P Sbjct: 185 PPTPTPSVPSPPDVTPTPPTPSVPSP---PDVTPTPPTPSVP 223 Score = 30.3 bits (65), Expect = 1.3 Identities = 32/113 (28%), Positives = 44/113 (38%), Gaps = 1/113 (0%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRST-PVPPSQFQPQLDGEYRTYLLSPS 492 P++P P P S P TP PP S+P T PV P P T +SP Sbjct: 96 PVSPPPPTPTPSV-PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 154 Query: 493 STRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPN 651 ++ + P T P+ P V P PT P P++ +PP+ Sbjct: 155 PPTPTPSVPS--PTPPVPTDPMPSPPPPV-SPPPPT-------PTPSVPSPPD 197 Score = 28.7 bits (61), Expect = 3.9 Identities = 19/49 (38%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +1 Query: 307 SGTPLAPRSPIPNASATPFRTPSPLP-PSWRGPESLPRSTPVPPSQFQP 450 S TP P P+P + P P P P PS P P TP PP+ P Sbjct: 164 SPTPPVPTDPMP-SPPPPVSPPPPTPTPSVPSP---PDVTPTPPTPSVP 208 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 32.7 bits (71), Expect = 0.24 Identities = 36/125 (28%), Positives = 49/125 (39%) Frame = +1 Query: 274 QRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 453 +R E R +G RSP+P +P R SP P R P S R P + +P Sbjct: 213 RRPRETSPQRKTGLSPRRRSPLPRRGLSP-RRRSPDSPHRRRPGSPIRRRGDTPPRRRP- 270 Query: 454 LDGEYRTYLLSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPA 633 SPS R+ + P R +P + G+ VRR P R P Sbjct: 271 ---------ASPSRGRSPSSPPPRRYRSPPRGSPRRIRGSPVRRR-SPLPLRRRSPPPRR 320 Query: 634 MRAPP 648 +R+PP Sbjct: 321 LRSPP 325 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 32.3 bits (70), Expect = 0.32 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 3/67 (4%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRST---PVPPSQFQPQLDGEYRTYLLS 486 P+ R+P+P P R +PLPP P ++ R P PP P D E Sbjct: 33 PMRRRAPLPPPPPPPMRRRAPLPPP--PPPAMRRRVLPRPPPPPPPLPMFDAEVLCCCYP 90 Query: 487 PSSTRTD 507 P+ R + Sbjct: 91 PTRVRRE 97 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 P P P P R +PLPP P + R P+PP Sbjct: 22 PLPPPPPPPPPPMRRRAPLPPP--PPPPMRRRAPLPP 56 >At4g21670.1 68417.m03139 double-stranded RNA-binding domain (DsRBD)-containing protein contains Pfam profile PF00035: Double-stranded RNA binding motif Length = 981 Score = 32.3 bits (70), Expect = 0.32 Identities = 30/111 (27%), Positives = 45/111 (40%), Gaps = 6/111 (5%) Frame = +1 Query: 340 PNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYL------LSPSSTR 501 P ASA+ P P+ + + + P P Q QPQ +L L S R Sbjct: 514 PMASASSVSVPVPVQVVQQAIQPSAMAFPSIPFQ-QPQQPTSIAKHLVPSEPSLQSSPAR 572 Query: 502 TDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNH 654 + + ES R L+L + R+P P+E P ++APP+H Sbjct: 573 EEGEVPESELDPDTRRRLLILQHGQDTRDPAPSEPSFPQ--RPPVQAPPSH 621 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 32.3 bits (70), Expect = 0.32 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +1 Query: 316 PLAPRSPIPNASATPFR--TPSPLPPSWRGPESLPRSTPVPP 435 P+ P P P+ + P R TP P PP + E R TP PP Sbjct: 135 PITPSPPPPSKTHEPSRPNTPPPPPPPSKTHEPSRRITPSPP 176 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +1 Query: 319 LAPRSPIPNASATPFR--TPSPLPPSWRGPESLPRSTPVPP 435 + P P P+ + R TPSP PPS S P + P PP Sbjct: 119 ITPSPPPPSKTHERSRPITPSPPPPSKTHEPSRPNTPPPPP 159 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 32.3 bits (70), Expect = 0.32 Identities = 20/57 (35%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPV--PPSQFQPQLDGEYRTYLLSP 489 P P P S P P P P + P LP TP+ PP F P + Y SP Sbjct: 55 PPPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPPQAYQAYYYRKSP 111 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 32.3 bits (70), Expect = 0.32 Identities = 38/126 (30%), Positives = 52/126 (41%), Gaps = 3/126 (2%) Frame = +1 Query: 280 DVEREG-LRGSGTPLAPR--SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 D E++G R L+PR SP+P +P R SP P R P S R P + +P Sbjct: 205 DAEKDGGPRRPRERLSPRRRSPLPRRGLSP-RRRSPDSPHRRRPGSPIRRRGDTPPRRRP 263 Query: 451 QLDGEYRTYLLSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNP 630 SPS R+ + P R +P + G+ VRR P R P Sbjct: 264 ----------ASPSRGRSPSSPPPRRYRSPPRGSPRRIRGSPVRRR-SPLPLRRRSPPPR 312 Query: 631 AMRAPP 648 +R+PP Sbjct: 313 RLRSPP 318 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 31.9 bits (69), Expect = 0.42 Identities = 31/116 (26%), Positives = 40/116 (34%), Gaps = 4/116 (3%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP---PSQFQPQLDGEYRTYLL 483 TP P P P+ P P P P + P P TP P P+ P + T + Sbjct: 127 TPKPPTKPPPSTPKPPTTKPPPSTP--KPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPV 184 Query: 484 SPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLR-HHPNPAMRAPP 648 T T + + P T P P V P PT + P P + PP Sbjct: 185 ITPPTPTPPVVTPPTPTPPVITPP--TPTPPVITPPTPTPPVVTPPTPTPPVVTPP 238 Score = 30.3 bits (65), Expect = 1.3 Identities = 30/115 (26%), Positives = 41/115 (35%), Gaps = 4/115 (3%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS 495 P + P P P P P PP + P P STP PP++ P P + Sbjct: 94 PPTVKPPHPKPPTKPH--PHPKPPIVKPPTKPPPSTPKPPTKPPPSTP--------KPPT 143 Query: 496 TRTDETIDESIQSQPYRT---TPLVLPGAKVRREPGPTESYLR-HHPNPAMRAPP 648 T+ + + +P T P P V P PT + P P + PP Sbjct: 144 TKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPP 198 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 31.5 bits (68), Expect = 0.55 Identities = 31/115 (26%), Positives = 41/115 (35%), Gaps = 2/115 (1%) Frame = +1 Query: 307 SGTPLAPRSPIPN--ASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYL 480 S P+ SP P +S P +P P PP P S+P PP T Sbjct: 47 SPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTP 106 Query: 481 LSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAP 645 +P T + ++ S P TT P PG T S P+P +P Sbjct: 107 PAPPQTVSPPPPPDASPSPPAPTTTNP-PPKPSPSPPGETPSPPGETPSPPKPSP 160 Score = 27.5 bits (58), Expect = 9.0 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = +1 Query: 478 LLSPSSTRTDETIDESIQSQPYRTT--PLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 648 +LSP S+ + T +Q+QP + P V P + P P S P P + +PP Sbjct: 9 ILSPPSSNSSTTAPPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVS--SSPPPPVVSSPP 65 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 31.5 bits (68), Expect = 0.55 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 453 P+ R P+P P R +P PP G P P PP F P+ Sbjct: 16 PMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPP---PPPPPMFDPK 58 >At3g01560.1 68416.m00086 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 511 Score = 31.5 bits (68), Expect = 0.55 Identities = 28/117 (23%), Positives = 45/117 (38%), Gaps = 12/117 (10%) Frame = +1 Query: 340 PNASATPFRTP---SPLPPSWRGPESLPR--STPVPPSQFQPQLDGEYRTYLLSPSSTRT 504 P ++ P++ P +P PS++ P P+ P P S + P+ Y+ P+ R Sbjct: 296 PPSNPPPYQAPQTQTPHQPSYQSPPQQPQYPQQPPPSSGYNPEEQPPYQMQSYPPNPPRQ 355 Query: 505 DETIDESIQSQ---PYRTTPLVLPGAKVRREPGPTESYL----RHHPNPAMRAPPNH 654 + Q P + P + GA R G YL + +P A P H Sbjct: 356 QPPAGSTPSQQFYNPPQPQPSMYDGAGGRSNSGFPSGYLSEPYTYSGSPMSSAKPPH 412 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 31.5 bits (68), Expect = 0.55 Identities = 27/73 (36%), Positives = 32/73 (43%), Gaps = 6/73 (8%) Frame = +1 Query: 298 LRGSGTPLAPRSPIPNASATPFRTPSP--LPPSWRGPESLPRSTPVP----PSQFQPQLD 459 L S P P S P +S +P +PSP PS P SL S+P P PS P Sbjct: 63 LSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPP 122 Query: 460 GEYRTYLLSPSST 498 LSPSS+ Sbjct: 123 SSSPLSSLSPSSS 135 Score = 31.1 bits (67), Expect = 0.73 Identities = 25/78 (32%), Positives = 31/78 (39%) Frame = +1 Query: 331 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDE 510 SP P +S+ PS L PS P SL S+P PP L + SP S+ Sbjct: 37 SPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSS 96 Query: 511 TIDESIQSQPYRTTPLVL 564 S+ P PL L Sbjct: 97 APPSSL--SPSSPPPLSL 112 >At3g05470.1 68416.m00599 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 884 Score = 31.1 bits (67), Expect = 0.73 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +1 Query: 328 RSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL 456 R+ +AS +P+ PSP P GP P P PP P L Sbjct: 86 RNLAESASFSPWPAPSPSPFPNGGPIESPAYPPAPPRPIPPHL 128 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 31.1 bits (67), Expect = 0.73 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 316 PLAPRSPIPNASATPF-RTPSPLPPSWRGPESLPRSTPVPPS 438 PL P P+ S+ P TPSP PP+ S P + PP+ Sbjct: 73 PLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPA 114 Score = 29.5 bits (63), Expect = 2.2 Identities = 26/89 (29%), Positives = 34/89 (38%) Frame = +1 Query: 307 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLS 486 S TP AP + + + P + PPS P P + PP Q P T S Sbjct: 109 SETPPAPPNESNDNNPPPSQDLQSPPPSSPSPNVGPTNPESPPLQSPPAPPASDPTN--S 166 Query: 487 PSSTRTDETIDESIQSQPYRTTPLVLPGA 573 P ++ D T IQ T+P P A Sbjct: 167 PPASPLDPTNPPPIQPSGPATSPPANPNA 195 Score = 29.1 bits (62), Expect = 2.9 Identities = 28/113 (24%), Positives = 43/113 (38%), Gaps = 5/113 (4%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPP---SWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS 495 P +P N++ P + P PP S P S P STP P SQ P P Sbjct: 23 PETPSENSALPPVDSSPPSPPADSSSTPPLSEP-STPPPDSQLPPLPSILPPLTDSPPPP 81 Query: 496 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPA--MRAPP 648 + + +D + P + P P P ++P P+ +++PP Sbjct: 82 SDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNESNDNNPPPSQDLQSPP 134 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 30.7 bits (66), Expect = 0.96 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 307 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 432 + TP AP + P+ + +P P+ PP+ GP P S P P Sbjct: 63 AATP-APATTPPSVAPSPADVPTASPPAPEGPTVSPSSAPGP 103 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 438 TP +P P A+ P TP+P P P + P PPS Sbjct: 36 TPPPVATPPPVATPPPAATPAPATPP---PAATPAPATTPPS 74 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 30.7 bits (66), Expect = 0.96 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +1 Query: 325 PRSPI-PNASATPFRTPS-PLPPSWRGPESLPRSTPVPPS 438 P P+ P+ S +P P P PP G ES P P+PP+ Sbjct: 92 PMMPMTPSTSPSPLTVPDMPSPPMPSGMESSPSPGPMPPA 131 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 30.7 bits (66), Expect = 0.96 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 PL+P P + ++P R P P P + LP +PP F P Sbjct: 38 PLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPP 82 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 PL PR +P P P PP PE PR P PP Sbjct: 68 PLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPP 107 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 30.7 bits (66), Expect = 0.96 Identities = 19/53 (35%), Positives = 21/53 (39%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLL 483 P SP P P PSP PP P LP P P P D + + LL Sbjct: 73 PPSP-PPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLPFASSLL 124 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 438 P SP P P P P PP P P P PPS Sbjct: 47 PPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPS 84 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 P P P P + P P P PP P LP +PP Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPP 102 >At1g13050.1 68414.m01513 expressed protein Length = 317 Score = 30.7 bits (66), Expect = 0.96 Identities = 24/76 (31%), Positives = 33/76 (43%) Frame = +1 Query: 340 PNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETID 519 P++ P R PLPP P S R + P + +P +R Y P+ R T Sbjct: 68 PSSRPLPLRPEEPLPPR-HNPNS-ARPLQLSPEEQRP----PHRGYGSEPTPWRRAPT-R 120 Query: 520 ESIQSQPYRTTPLVLP 567 + Q P RT P+ LP Sbjct: 121 PAYQQGPKRTKPMTLP 136 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQ 441 P P+SP P S+ P P PP+ + S PV P++ Sbjct: 164 PTRPKSPPPRKSSFPPSRSPPPPPAKKNASKNSTSAPVSPAK 205 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +1 Query: 331 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 SP P+ S P R+ P P R PR + PPS+ P Sbjct: 145 SPSPSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPP 184 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQ 441 P P+SP P S+ P P PP+ + S PV P++ Sbjct: 164 PTRPKSPPPRKSSFPPSRSPPPPPAKKNASKNSTSAPVSPAK 205 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +1 Query: 331 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 SP P+ S P R+ P P R PR + PPS+ P Sbjct: 145 SPSPSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPP 184 >At3g25500.1 68416.m03171 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 1051 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +1 Query: 358 PFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSP 489 P +P P PPS LP S+ PPS P + Y SP Sbjct: 32 PIDSPPPSPPSPPPLPKLPFSSTTPPSSSDPNASPFFPLYPSSP 75 >At2g18470.1 68415.m02151 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 633 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +1 Query: 331 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 SP N ++T P+P PPS P+ S+P P S P Sbjct: 18 SPPSNTNSTTSSPPAPSPPSPTPPQGDSSSSPPPDSTSPP 57 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 P SPI + P +P P PP + P P +P PP Sbjct: 503 PPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPP 539 Score = 29.9 bits (64), Expect = 1.7 Identities = 33/118 (27%), Positives = 40/118 (33%), Gaps = 7/118 (5%) Frame = +1 Query: 316 PLAPR-SPIPN----ASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYL 480 P P+ SP PN S FR P PP P P +P PP + P Y Sbjct: 469 PQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPP--VYS 526 Query: 481 LSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLR--HHPNPAMRAPP 648 P + S P P+ P V P P S H P P + +PP Sbjct: 527 PPPPPPVYSPPPPPPVHSPP---PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 581 Score = 29.1 bits (62), Expect = 2.9 Identities = 29/113 (25%), Positives = 47/113 (41%), Gaps = 1/113 (0%) Frame = +1 Query: 343 NASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETIDE 522 ++ ATP ++PSP+P P+ +P P + Q ++R SP + + Sbjct: 389 SSQATPSKSPSPVPTRPVHKPQPPKESPQPNDPYN-QSPVKFRR---SPPPPQ--QPHHH 442 Query: 523 SIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAP-PNHDYRDTLMK 678 + S P ++P P V P P H P P +P PN Y + +K Sbjct: 443 VVHSPPPASSPPTSP--PVHSTPSPV-----HKPQPPKESPQPNDPYDQSPVK 488 Score = 28.7 bits (61), Expect = 3.9 Identities = 30/116 (25%), Positives = 38/116 (32%), Gaps = 2/116 (1%) Frame = +1 Query: 307 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP--SQFQPQLDGEYRTYL 480 S P SP P + P SP PP + P P +P PP S P Y Sbjct: 586 SPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYS 645 Query: 481 LSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 648 P +S P + PL+ P P S P+ + APP Sbjct: 646 PPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPP 701 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 +P P P P S P SP PP + P P +P PPS P Sbjct: 581 SPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPP 626 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = +1 Query: 304 GSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDG 462 G+ + A S I + + P PLPP G +L S P+PP P G Sbjct: 158 GASSSSAALSSITESEDSVLVNPPPLPPLPDGDNALSASLPLPPLPPLPPTTG 210 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPES-----LPRSTPVPPS 438 P AP +PI + S+ P P P PP+ P+S + S P PP+ Sbjct: 714 PPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPA 759 Score = 27.9 bits (59), Expect = 6.8 Identities = 25/106 (23%), Positives = 40/106 (37%), Gaps = 6/106 (5%) Frame = +1 Query: 136 PGTPAGRDLVRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGT 315 P T + + + D+ + + + EDA L +KLV + + S + Sbjct: 446 PPTDSVKKFIAEDVHSVLQINNQEQNASEDATKLLHQESPSLKLVHHSATVKPLVDDSKS 505 Query: 316 PLA-----PRSPIPN-ASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 P P+SP + A F P+P PP P+ P PP Sbjct: 506 PENAEENFPKSPSAHDGKAISFSPPTPSPPHPVRPQLAQAGAPPPP 551 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +1 Query: 325 PRSPIPNASATPFRT-PSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRT 474 P +P P + TP + P+P P P+ P P P + + + + Y T Sbjct: 94 PPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKPAPGGEVEDETEFSYET 144 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +1 Query: 322 APRSPIPNASATPFRTPSPLP-PSWRGPESLPRSTPVPP 435 AP+ P P + P P P P P+ P+ P+ P PP Sbjct: 25 APKPPKPKPAPAP-TPPKPKPTPAPTPPKPKPKPAPTPP 62 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 453 TP P+ P TP+P PP + P P TP P + P+ Sbjct: 82 TPPKPKPKPAPTPPNPKPTPAPTPPKPK-PAPAPAPTPAPKPKPAPK 127 >At5g35190.1 68418.m04170 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 328 Score = 29.9 bits (64), Expect = 1.7 Identities = 28/113 (24%), Positives = 45/113 (39%), Gaps = 3/113 (2%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRT 504 P + N+ P+ +PSP P S+P PP + P + Y++ P Sbjct: 224 PPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPEVSYKS---PPPPPYY 280 Query: 505 DETIDESIQSQPYRTTPLVL---PGAKVRREPGPTESYLRHHPNPAMRAPPNH 654 +++ S +S P PL + P P P SY + P P + PN+ Sbjct: 281 SPSLEVSYKSPP----PLFVYNFPPPPPFYSPSPKVSY-KSPPAPYVSKTPNY 328 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 PL P P P+ P P P P + P P S P PP P Sbjct: 1074 PLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPP 1118 Score = 27.9 bits (59), Expect = 6.8 Identities = 24/64 (37%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = +1 Query: 268 VIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWR-GPESLPRSTPVPPSQF 444 V ++ E L PL SP P P PSP PPS P SLP P PP+ Sbjct: 1047 VAEKSTEFNPLPEDSPPLPQESPPP----LPPLPPSPPPPSPPLPPSSLP---PPPPAAL 1099 Query: 445 QPQL 456 P L Sbjct: 1100 FPPL 1103 >At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein similar to beta-glucan-elicitor receptor GI:1752734 from [Glycine max] Length = 745 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/46 (41%), Positives = 21/46 (45%) Frame = +1 Query: 358 PFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS 495 PF+ P PPS P LP S PPSQ Q + T L P S Sbjct: 16 PFKKPKNRPPSPPPPLPLPPSPSPPPSQ-QMSSSRQKNTPFLFPRS 60 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 29.9 bits (64), Expect = 1.7 Identities = 32/112 (28%), Positives = 48/112 (42%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPS 492 TP+ SP+P TP + PSP+P + S +TPV + P + Sbjct: 445 TPVQKPSPVPT---TPVQKPSPVPTTPVHEPSPVLATPV--DKPSPVPSRPVQKPQPPKE 499 Query: 493 STRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 648 S + D+ D+S ++ R +P P A V P P Y P P + +PP Sbjct: 500 SPQPDDPYDQSPVTK--RRSP---PPAPVNSPPPPV--YSPPPPPPPVHSPP 544 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = +1 Query: 328 RSPIP---NASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 RSP P N+ P +P P PP P P +P PP + P Sbjct: 516 RSPPPAPVNSPPPPVYSPPPPPPPVHSPPP-PVHSPPPPPVYSP 558 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 29.9 bits (64), Expect = 1.7 Identities = 35/106 (33%), Positives = 44/106 (41%), Gaps = 8/106 (7%) Frame = +1 Query: 304 GSGTPL---APRSPIPNASATPFRTPSPLPPS---WRGPES-LPRSTPVPPSQFQPQLDG 462 G +PL P SP+P P +P+P P S GP+S LP P P S P D Sbjct: 185 GPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDS 244 Query: 463 EYRTYLLSPSSTRTDETIDESIQSQPYRTTPLVLPGA-KVRREPGP 597 + PS + T D + S P +PL PG PGP Sbjct: 245 PLPSPGPPPSPSPTPGP-DSPLPS-PGPDSPLPSPGPDPPLPSPGP 288 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 TP P P P TP P P+ P P TP PP Sbjct: 134 TPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPP 174 >At4g11260.1 68417.m01822 phosphatase-related low similarity to protein phosphatase T [Saccharomyces cerevisiae] GI:897806; contains Pfam profiles PF00515: TPR Domain, PF05002: SGS domain, PF04969: CS domain Length = 358 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = +1 Query: 160 LVRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVE-REGLRGSGTPLAPRSP 336 L +G K+++Y E ++ N P K++ + D+ E + P+ P Sbjct: 74 LRKGTACMKLEEYSTAKAALEKGASVAPNEPKFKKMIDECDLRIAEEEKDLVQPMPPS-- 131 Query: 337 IPNASATPFRTPSPLPP 387 +P++S TP T + PP Sbjct: 132 LPSSSTTPLATEADAPP 148 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPP-SWRGPESLPRSTPVPPSQFQPQL 456 P P P S P+ P P PP + P S P P PP QP + Sbjct: 411 PSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYM 455 >At3g10070.1 68416.m01207 transcription initiation factor IID (TFIID) subunit A family protein similar to hypothetical protein GB:CAB10099 [Schizosaccharomyces pombe]; contains Pfam profile PF03847: Transcription initiation factor TFIID subunit A Length = 539 Score = 29.9 bits (64), Expect = 1.7 Identities = 23/92 (25%), Positives = 35/92 (38%), Gaps = 4/92 (4%) Frame = +1 Query: 385 PSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETIDESIQSQPYRTTPLVL 564 P S P TP PS +P + + +PS+ + ++ SI S P +P + Sbjct: 4 PRQSSTASQPPETPPQPSDSKPSTLTQIQP---TPSTNPSPSSVVSSIPSSPAPQSPSLN 60 Query: 565 PGAK----VRREPGPTESYLRHHPNPAMRAPP 648 P R P +H P +R PP Sbjct: 61 PNPNPPQYTRPVTSPATQQQQHLSQPLVRPPP 92 >At5g55020.1 68418.m06853 myb family transcription factor (MYB120) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 523 Score = 29.5 bits (63), Expect = 2.2 Identities = 32/117 (27%), Positives = 45/117 (38%), Gaps = 14/117 (11%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESL------PRSTP------VPPSQFQPQLDGEY 468 PRS I N + F P P PP + P SL +TP V + F P Y Sbjct: 260 PRSQINNNNNGNFTFPRP-PPLLQPPSSLFAKRYNNANTPLNCINRVSTAPFSPVSRDSY 318 Query: 469 RTYLLSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTE--SYLRHHPNPA 633 ++L P + T +T + PY ++P P T S+L H P+ Sbjct: 319 TSFLTLPYPSPTAQTATYHNTNNPYSSSPSFSLNPSSSSYPTSTSSPSFLHSHYTPS 375 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 29.5 bits (63), Expect = 2.2 Identities = 35/129 (27%), Positives = 49/129 (37%), Gaps = 12/129 (9%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRT----YL 480 T +A P AS P + SPLP LP PP + P + EY++ Y+ Sbjct: 18 TMVAAYEPETYASPPPLYS-SPLPEVEYKTPPLPYVDSSPPPTYTPAPEVEYKSPPPPYV 76 Query: 481 LS---PSSTRTDETIDESIQSQPY----RTTPLVLPGAKVRREPGPTESYLRHHPNPAMR 639 S P + +D PY P P KV + P Y+ + P P Sbjct: 77 YSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYNSPPPPYY 135 Query: 640 AP-PNHDYR 663 +P P DY+ Sbjct: 136 SPSPKVDYK 144 >At3g46620.1 68416.m05061 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 395 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -3 Query: 630 WVGVMTQVTLCGARLPSDLSSREHERSGAVRLTLNRL 520 W+ + +C LPSD R +E AV +T+ RL Sbjct: 245 WLSIRNSCPVCRFELPSDPIQRSNEEEHAVGMTIWRL 281 >At2g45470.1 68415.m05655 fasciclin-like arabinogalactan-protein (FLA8) Length = 420 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTP 426 P+ +P P + +P P PP+ PES P +P Sbjct: 346 PVTAPTPSPADAPSPTAASPPAPPTDESPESAPSDSP 382 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +1 Query: 328 RSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 453 +SP P + P P+P P P S P PP+ P+ Sbjct: 336 KSPSPAPAPEPVTAPTPSPAD--APSPTAASPPAPPTDESPE 375 >At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 29.5 bits (63), Expect = 2.2 Identities = 20/74 (27%), Positives = 28/74 (37%) Frame = +1 Query: 211 LRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPS 390 +R EDA+ + + P+ GS P P P+ + P TP+P PS Sbjct: 28 VRFEDAKTYYLSPPSGSHGTPPSHTPPSSNCGS-PPYDPSPSTPSHPSPPSHTPTPSTPS 86 Query: 391 WRGPESLPRSTPVP 432 P TP P Sbjct: 87 HTPTPHTPSHTPTP 100 >At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 29.5 bits (63), Expect = 2.2 Identities = 20/74 (27%), Positives = 28/74 (37%) Frame = +1 Query: 211 LRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPS 390 +R EDA+ + + P+ GS P P P+ + P TP+P PS Sbjct: 28 VRFEDAKTYYLSPPSGSHGTPPSHTPPSSNCGS-PPYDPSPSTPSHPSPPSHTPTPSTPS 86 Query: 391 WRGPESLPRSTPVP 432 P TP P Sbjct: 87 HTPTPHTPSHTPTP 100 >At2g27100.1 68415.m03256 C2H2 zinc-finger protein SERRATE (SE) identical to C2H2 zinc-finger protein SERRATE GI:14486602 from [Arabidopsis thaliana] Length = 720 Score = 29.5 bits (63), Expect = 2.2 Identities = 37/111 (33%), Positives = 45/111 (40%), Gaps = 16/111 (14%) Frame = +1 Query: 379 LPPSWRGPESLP-RST-----PVPPSQFQPQLDGEYRTYLLS-----PSSTRTDET-IDE 522 LPPS LP +ST P PPS PQ + E L S R DE I+ Sbjct: 6 LPPSDSVDNRLPEKSTSSSPPPPPPSSSLPQQEQEQDQQQLPLRRERDSRERRDERDIER 65 Query: 523 SIQSQPYRT-TPLVLPGAKVRREPG--PTESYL-RHHPNPAMRAPPNHDYR 663 ++ R +PL P +R P P Y R H P R+PP YR Sbjct: 66 PPPNRRERDRSPLPPPRRDYKRRPSLSPPPPYRDRRHSPPQRRSPPQKRYR 116 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 29.5 bits (63), Expect = 2.2 Identities = 28/107 (26%), Positives = 43/107 (40%), Gaps = 1/107 (0%) Frame = +1 Query: 334 PIPNASATP-FRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDE 510 P P+ +P R P PPS + + R+TP PPS ++ +R PSS Sbjct: 426 PPPSFKMSPTVRVLPPPPPSSKMSPTF-RATPPPPSS---KMSPSFRATPPPPSS----- 476 Query: 511 TIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPN 651 + S ++ P + + P K P P Y P P+ P+ Sbjct: 477 KMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPS 523 Score = 28.7 bits (61), Expect = 3.9 Identities = 26/117 (22%), Positives = 40/117 (34%), Gaps = 12/117 (10%) Frame = +1 Query: 334 PIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDG--------EYRTYLLSP 489 P P++ +P +P PPS + S + P P S+ P + EY P Sbjct: 457 PPPSSKMSPSFRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPP 516 Query: 490 SSTRTDET----IDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 648 SS + + P P + + P P Y+ P P + PP Sbjct: 517 SSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPP 573 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 432 P P SP P + P+ SP PPS P S+P P Sbjct: 529 PPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPP 567 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 29.5 bits (63), Expect = 2.2 Identities = 17/50 (34%), Positives = 20/50 (40%) Frame = +1 Query: 295 GLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQF 444 G R PL P ++ P T P G S P STP PP Q+ Sbjct: 239 GGRSPPLPLPPGQFTAGNASFPSSTQPPPGQYMAGNASFPSSTPPPPGQY 288 Score = 27.9 bits (59), Expect = 6.8 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSW--RGPESLPRSTPVPPSQF 444 P SP S P PLPP G S P ST PP Q+ Sbjct: 229 PSSPSQIHSGGGRSPPLPLPPGQFTAGNASFPSSTQPPPGQY 270 Score = 27.9 bits (59), Expect = 6.8 Identities = 25/92 (27%), Positives = 35/92 (38%), Gaps = 4/92 (4%) Frame = +1 Query: 307 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLS 486 S T P + ++ P TP P G STP+PP Q+ P ++ + T S Sbjct: 261 SSTQPPPGQYMAGNASFPSSTPPPPGQYMAGNAPFSSSTPLPPGQY-PAVNAQLSTSAPS 319 Query: 487 ---PSSTRTDETIDESIQSQPYRTTP-LVLPG 570 P T S +QP P +PG Sbjct: 320 VPLPPGQYTAVNAPFSTSTQPVSLPPGQYMPG 351 >At1g53645.1 68414.m06102 hydroxyproline-rich glycoprotein family protein Length = 523 Score = 29.5 bits (63), Expect = 2.2 Identities = 19/72 (26%), Positives = 25/72 (34%) Frame = +1 Query: 250 PNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPV 429 P+ I + + G G PL +PI R P P P R R+ V Sbjct: 200 PDNIFNALGNEFSHPSGAGRGKPLVESAPIRQEDNRQIRRPPPPPQQQRVQPQQKRAPTV 259 Query: 430 PPSQFQPQLDGE 465 +PQL E Sbjct: 260 KDGTPKPQLSAE 271 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 358 PFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRT 474 P+ +PSP P P S+P PP + P EY++ Sbjct: 721 PYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKS 759 Score = 27.9 bits (59), Expect = 6.8 Identities = 30/112 (26%), Positives = 39/112 (34%) Frame = +1 Query: 313 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPS 492 TP SP P P+ +PSP P P S+P PP + P Y+ SP Sbjct: 560 TPYVYHSPPP----PPYYSPSPKPAYKSSPPPYVYSSP-PPPYYSPAPKPVYK----SPP 610 Query: 493 STRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 648 + S + T P V P P Y P P ++PP Sbjct: 611 PPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPP--PYYSPTPKPTYKSPP 660 Score = 27.5 bits (58), Expect = 9.0 Identities = 27/108 (25%), Positives = 38/108 (35%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRT 504 P + N+ P+ +PSP P P S+P PP + P Y+ SP Sbjct: 610 PPPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSP-PPPYYSPTPKPTYK----SPPPPYV 664 Query: 505 DETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 648 + S + T P V P P Y P P ++PP Sbjct: 665 YSSPPPPYYSPSPKPTYKSPPPPYVYSSPPP--PYYSPAPKPTYKSPP 710 >At1g08060.2 68414.m00881 MOM1 identical to MOM1 (mutation in a 'Morpheus molecule') [Arabidopsis thaliana] gi|8132770|gb|AAF73381.1| Length = 2001 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 319 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 453 +AP + A+ R+P+P S+R S P +T P S PQ Sbjct: 1919 IAPTPSVTPATNPGLRSPAPHLNSYRPSSSTPVATATPTSSVPPQ 1963 >At1g08060.1 68414.m00880 MOM1 identical to MOM1 (mutation in a 'Morpheus molecule') [Arabidopsis thaliana] gi|8132770|gb|AAF73381.1| Length = 2001 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 319 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 453 +AP + A+ R+P+P S+R S P +T P S PQ Sbjct: 1919 IAPTPSVTPATNPGLRSPAPHLNSYRPSSSTPVATATPTSSVPPQ 1963 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +1 Query: 370 PSPLPPSWRG-PESLPRSTPVPPSQFQPQLDGEY 468 P PL P +G P S+P S P P Q Q Q Y Sbjct: 109 PPPLSPDGKGSPPSVPSSPPSPKGQSQGQQQPPY 142 >At3g32904.1 68416.m04164 hypothetical protein Length = 330 Score = 29.1 bits (62), Expect = 2.9 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = +1 Query: 295 GLRGSGTPLAPRSPIPNA-SATPFRTPSPLPPSWRGPESLPR--STPVPPSQFQP 450 G + GTP P +P N+ S P T P P W P S+P+ S+P P P Sbjct: 273 GFQQWGTP--PTAPQWNSPSNVPQWTIPPTTPQWGTPSSMPQWSSSPTAPQLSSP 325 >At3g07130.1 68416.m00849 serine/threonine protein phosphatase family protein contains similarity to purple acid phosphatase [Arabidopsis thaliana] gi|20257489|gb|AAM15914 Length = 532 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 Query: 211 GHVRHNRRSSR*YPHGLSPCRPEYL 137 GHV RS+R Y + L PC P Y+ Sbjct: 395 GHVHAYERSNRVYNYELDPCGPVYI 419 >At3g02670.1 68416.m00258 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 217 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +1 Query: 337 IPNASATP-FRTPSPLPPSWRGPESLPRS-TPVPP 435 IP +P FR P P PPS G LP P+PP Sbjct: 146 IPGIPGSPGFRLPFPFPPSGGGIPGLPLPFPPLPP 180 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 29.1 bits (62), Expect = 2.9 Identities = 27/115 (23%), Positives = 37/115 (32%), Gaps = 3/115 (2%) Frame = +1 Query: 325 PRSPIP-NASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTR 501 P P P + TP +P PP P + S P+ P +P P Sbjct: 435 PVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKP 494 Query: 502 TDETIDESIQSQPYR--TTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDY 660 T ++ P + TP P K PT +Y P + PP Y Sbjct: 495 PTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTY 549 Score = 28.7 bits (61), Expect = 3.9 Identities = 30/115 (26%), Positives = 37/115 (32%), Gaps = 3/115 (2%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPV-PPSQFQPQLDGEYRTYLLSPSSTR 501 P P P TP +P PP P + S PV PP +P P Sbjct: 335 PIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKP 394 Query: 502 TDETIDESIQSQPYR--TTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDY 660 T I+ P + TP P K+ PT Y P + PP Y Sbjct: 395 PTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIY 449 >At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 432 PL +P P + P P+P P P P TP P Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAP 329 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/50 (28%), Positives = 19/50 (38%) Frame = +1 Query: 283 VEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 432 ++ G + P +P P + P PSP P S P P P P Sbjct: 282 IDALGAHFAPLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAP 331 >At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 432 PL +P P + P P+P P P P TP P Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAP 329 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/50 (28%), Positives = 19/50 (38%) Frame = +1 Query: 283 VEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 432 ++ G + P +P P + P PSP P S P P P P Sbjct: 282 IDALGAHFAPLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAP 331 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +1 Query: 250 PNQIKLVIQRDVEREGLRGSGTP-LAPRSPIPNASATPFRTPSPLPPSWRG 399 P + + +++ V L GT L P P+P A+ P P PP RG Sbjct: 235 PPPLPMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPPPPGARG 285 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 481 LSPSSTRTDETIDESIQSQPYRTTPLVLPGAKV 579 +SP ST+T ES+ QP R ++ P +KV Sbjct: 62 VSPRSTKTSNDRSESLAKQPIRPKTVLSPPSKV 94 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 29.1 bits (62), Expect = 2.9 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = +1 Query: 307 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 453 S P P PN P TP P PPS S P S PPS QPQ Sbjct: 59 SPPPATAAQPPPNQP--PNTTPPPTPPS-----SPPPSITPPPSPPQPQ 100 Score = 27.5 bits (58), Expect = 9.0 Identities = 19/45 (42%), Positives = 21/45 (46%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLD 459 P P PN + P PS PPS P S P+ P PP Q P D Sbjct: 70 PNQP-PNTTPPP-TPPSSPPPSITPPPSPPQ--PQPPPQSTPTGD 110 >At5g26070.1 68418.m03102 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; similar to root nodule extensin [Pisum sativum] gi|15021750|gb|AAK77902; Common family members: At5g19800, At5g57070, At1g72790 [Arabidopsis thaliana] Length = 102 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 5/38 (13%) Frame = +1 Query: 334 PIPNASATPFRTPSPLP-----PSWRGPESLPRSTPVP 432 P+ + S +P+R+P LP P++ P +LP + P+P Sbjct: 38 PLYSPSPSPYRSPVTLPPPPPHPAYSRPVALPPTLPIP 75 >At4g01810.1 68417.m00238 protein transport protein-related related to Sec23 protein [Homo sapiens] gi|1296664|emb|CAA65774 Length = 880 Score = 28.7 bits (61), Expect = 3.9 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 5/56 (8%) Frame = +1 Query: 304 GSGTPLAPRSPIPNASATPF-RTP----SPLPPSWRGPESLPRSTPVPPSQFQPQL 456 G+ TPL P P P TP +P SP+PP + P P PS P L Sbjct: 13 GTLTPLEPNRPSPQPDRTPVPHSPPVVASPIPPRFPQPSFRPDQMS-SPSMKSPSL 67 >At3g57380.1 68416.m06387 expressed protein contains Pfam domain, PF04577: Protein of unknown function (DUF563) Length = 504 Score = 28.7 bits (61), Expect = 3.9 Identities = 17/60 (28%), Positives = 30/60 (50%) Frame = +1 Query: 169 GDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNA 348 GDI++++ DY D + + FK A +K+ + VE + G+ T L R+ + A Sbjct: 235 GDIVSQLSDYPPVDFNGDKRTHCFKEAIVGLKIHDELTVESSLMLGNKTILDFRNVLDQA 294 >At3g24860.1 68416.m03118 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 310 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +3 Query: 537 AVPHHSSRAPGS*GPKGAW--PHRELPASSPQPSNEGTS*P 653 A P +S P P A PH++ P S PQP+N + P Sbjct: 2 ATPSPTSSPPSDSNPNSAATPPHQKQPPSPPQPTNPSSPPP 42 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 P P P+P P +P P PP + P S P +P PP Sbjct: 413 PPPPSPPLP----PPVYSPPPSPPVFSPPPSPPVYSPPPP 448 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQF 444 P P P++ P+ P PLP P P S P PP + Sbjct: 41 PVDPSPSSVHRPYPPPPPLPDFAPQPLLPPPSPPPPPPAY 80 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 28.7 bits (61), Expect = 3.9 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = +1 Query: 316 PLAPRSPIPNASATPF-RTP--SPLPPSWRGPESLPRSTPVPPSQFQPQL 456 P P P P P + P SP PP+ P +P +P PP+ P L Sbjct: 160 PQVPVMPPPQVPVKPHPKVPVISPDPPATLPPPKVPVISPDPPTTLPPPL 209 >At1g75340.1 68414.m08751 zinc finger (CCCH-type) family protein weak similarity to Nucleoporin NUP42 (Nuclear pore protein NUP42) (Swiss-Prot:P49686) [Saccharomyces cerevisiae]; contains Pfam profile PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 435 Score = 28.7 bits (61), Expect = 3.9 Identities = 19/52 (36%), Positives = 24/52 (46%) Frame = +1 Query: 295 GLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 GL SG P A S +A TP P+P G ++ P ST P+ F P Sbjct: 295 GLSSSGPPNAFASFNKQPNAFSVNTPQPVPSGPSGFQTNP-STTFKPASFGP 345 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 28.7 bits (61), Expect = 3.9 Identities = 18/51 (35%), Positives = 22/51 (43%) Frame = +1 Query: 298 LRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 L+GS P P P+P A P P P PP R + P P P + P Sbjct: 503 LKGSAPPPPPPPPLPTTIAAP--PPPPPPP--RAAVAPPPPPPPPGTAAAP 549 Score = 28.3 bits (60), Expect = 5.1 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +1 Query: 295 GLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 G GSG P P P+P A+ TP P PP P PP Sbjct: 583 GNSGSGGPPPPPPPMPLANGA---TPPPPPPPMAMANGAAGPPPPPP 626 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 28.7 bits (61), Expect = 3.9 Identities = 19/43 (44%), Positives = 21/43 (48%) Frame = +1 Query: 307 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 +G P P SP P S P SP PPS PE P S+ PP Sbjct: 143 AGQPPPPESP-PPESLPPPSPESPSPPS---PEPPPPSSLEPP 181 Score = 27.9 bits (59), Expect = 6.8 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = +1 Query: 289 REGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 R +GT P P S P P P P S S P P PPS +P Sbjct: 131 RRTTAAAGTTTIAGQPPPPESPPPESLPPPSPES----PSPPSPEPPPPSSLEP 180 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 28.7 bits (61), Expect = 3.9 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +1 Query: 322 APRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 453 +P P+P S+ + SP PPS +S +P PPS PQ Sbjct: 62 SPPPPLPENSSDGSSSSSPPPPSDSSSQS---QSPPPPSTSPPQ 102 >At1g49190.1 68414.m05515 two-component responsive regulator family protein / response regulator family protein contains Pfam profile: PF00072 response regulator receiver domain ;contains similarity to two-component response regulator protein (ARR2) GI:4210451 from [Arabidopsis thaliana] Length = 608 Score = 28.7 bits (61), Expect = 3.9 Identities = 17/71 (23%), Positives = 24/71 (33%) Frame = +1 Query: 448 PQLDGEYRTYLLSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPN 627 P L G PS IQ Y+ L + ++ P P YL HH Sbjct: 498 PSLQGSDNVNTTIPSYLMNGPATLNQIQQNQYQNGFLTMNNNQIITNPPPPLPYLDHHHQ 557 Query: 628 PAMRAPPNHDY 660 ++ P +Y Sbjct: 558 QQHQSSPQFNY 568 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/46 (32%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = +1 Query: 325 PRSPIPNASATPFRTPSPLPPSWR--GPESLPRS--TPVPPSQFQP 450 P P+ P +P+P PP W P +P+ P PP F P Sbjct: 30 PHPPVEVEENQPKTSPTPPPPHWMRYPPVLMPQMMYAPPPPMPFSP 75 >At5g56980.1 68418.m07112 expressed protein non-consensus CG donor splice site at exon 1, GA donor splice site at exon 3 Length = 379 Score = 28.3 bits (60), Expect = 5.1 Identities = 28/96 (29%), Positives = 41/96 (42%), Gaps = 4/96 (4%) Frame = +1 Query: 370 PSPLP-PSWRGPESLPRSTPVPPSQFQ-PQLDGEYRTYLLSPSSTRTDETIDESIQSQPY 543 P P P P R P L R + S F+ Q + E Y + T+ T ESI ++ Sbjct: 149 PDPAPAPLQRAPSLLDRVKSINMSYFKFQQYNPEENDY-----AHHTEPTRFESIPTRMG 203 Query: 544 RTTPLVLPGAKVRREPGPTESYLRHHPNP--AMRAP 645 R P+ + ++ E PT + + NP RAP Sbjct: 204 RVDPIDISKFRIPEEDQPTGTGVNSQINPPGLTRAP 239 >At5g56890.1 68418.m07099 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 1113 Score = 28.3 bits (60), Expect = 5.1 Identities = 27/105 (25%), Positives = 39/105 (37%), Gaps = 4/105 (3%) Frame = +1 Query: 370 PSPLPPSWRGP-ESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTD---ETIDESIQSQ 537 PSPLPP P +S + + PP Q L+SP+ + I ++ Sbjct: 362 PSPLPPHLISPKKSNRKGSMTPPPQSHHAPSPPIPDSLISPAHAPVSFSMKRISPALAPS 421 Query: 538 PYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDYRDTL 672 P + PL + P L+ P P PPN D T+ Sbjct: 422 PTQVFPLRSSSRPSKSRKFPLGPPLQAFPPP----PPNSDCSSTI 462 >At5g21160.1 68418.m02528 La domain-containing protein / proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965, PF05383: La domain Length = 826 Score = 28.3 bits (60), Expect = 5.1 Identities = 26/97 (26%), Positives = 36/97 (37%) Frame = +1 Query: 370 PSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETIDESIQSQPYRT 549 P+P PPS P S+P TP Q + + G+ +PS R + S Q+ P Sbjct: 66 PAPAPPSKNIPTSIPIPTPAVTGQAKSKGGGKANPGHKNPSG-RHSKPGPRSNQNGP-PP 123 Query: 550 TPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDY 660 P ++ P P L H P P Y Sbjct: 124 PPYLVHAVPYHPPPFPPMVPLPHAAGPDFPYAPYPPY 160 >At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical to gi_11935088_gb_AAG41964 Length = 209 Score = 28.3 bits (60), Expect = 5.1 Identities = 28/110 (25%), Positives = 45/110 (40%), Gaps = 8/110 (7%) Frame = +1 Query: 322 APRSPIPNASATPFRTP-----SPLP-PSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLL 483 +P+SP P + ++P TP P+P P P S P P P + P + Sbjct: 69 SPKSPAPVSESSPPPTPVPESSPPVPAPMVSSPVSSP-PVPAPVADSPPAPVAAPVADVP 127 Query: 484 SPSSTRTDETIDES--IQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPN 627 +P+ ++ +T +S Q+ P L+ P A PGP P+ Sbjct: 128 APAPSKHKKTTKKSKKHQAAPAPAPELLGPPAPPTESPGPNSDAFSPGPS 177 >At3g16770.1 68416.m02141 AP2 domain-containing protein RAP2.3 (RAP2.3) identical to GI:2281631 [Arabidopsis thaliana]; identical to cDNA EBP GI:2190330 Length = 248 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 376 PLPPSWRGPESLPRSTPVPPSQ 441 P PP++ P S PRST PP++ Sbjct: 140 PPPPNYTPPPSSPRSTDQPPAK 161 >At2g41870.1 68415.m05177 remorin family protein contains Pfam domain, PF03763: Remorin, C-terminal region Length = 274 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/67 (23%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Frame = +1 Query: 331 SPIPNASATPFRTPSPLPPSWRGPESLPRS-TPVPPSQFQPQLDGEYRTYLLSPSSTRTD 507 +P P ++ P PP++RG S PRS T + + + E+ +++ SS + Sbjct: 33 TPAPEDNSRTMTATLPPPPAFRGYFSPPRSATTMSEGENFTTISREFNALVIAGSSMENN 92 Query: 508 ETIDESI 528 E + + Sbjct: 93 ELMTRDV 99 >At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (GP:2708305) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (7 copies)|19877698|gb|AU238529.1|AU238529 Length = 554 Score = 28.3 bits (60), Expect = 5.1 Identities = 20/76 (26%), Positives = 27/76 (35%) Frame = +1 Query: 319 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSST 498 L S +P SA P P PP +P P F+P + S Sbjct: 23 LQDASSLPGFSAIPPVVPPSFPPPMAPIPMMPHPPVARPPTFRPPVSQNGGVKTSDSDSE 82 Query: 499 RTDETIDESIQSQPYR 546 DE I+ S +S+ R Sbjct: 83 SDDEHIEISEESKQVR 98 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/51 (35%), Positives = 21/51 (41%), Gaps = 5/51 (9%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPS-----PLPPSWRGPESLPRSTPVPPSQFQPQ 453 P P+ P N+ A P PS P PP P S P P PP + Q Sbjct: 9 PPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQ 59 >At1g78310.1 68414.m09126 VQ motif-containing protein contains PF05678: VQ motif Length = 311 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 340 PNASATPFRTPSPLPPSWRGPESLPRSTPVPP 435 P + F P P PPS +++P S P PP Sbjct: 233 PPSQHNSFPPPHPPPPSSAVSQTVPTSIPAPP 264 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 28.3 bits (60), Expect = 5.1 Identities = 36/129 (27%), Positives = 42/129 (32%), Gaps = 16/129 (12%) Frame = +1 Query: 307 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP------------PSQFQP 450 S P P P S P + P PP P P TP P P F P Sbjct: 46 SPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPP 105 Query: 451 QLDGEYRTYLLSPSSTRTDE----TIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRH 618 +D SP E DE +S P P LP + GP + +H Sbjct: 106 PIDSPPPESTNSPPPPEVFEPPPPPADED-ESPPAPPPPEQLPPPASSPQGGPKKP-KKH 163 Query: 619 HPNPAMRAP 645 HP PA P Sbjct: 164 HPGPATSPP 172 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +1 Query: 319 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP-SQFQPQLDG 462 + P S P P P P PP ++LPR P PP S +P+ DG Sbjct: 85 IKPLSSPPPPQPPPRSQPPPKPPQ----KNLPRRHPPPPRSPEKPKRDG 129 >At1g03780.1 68414.m00359 targeting protein-related similar to microtubule-associated protein / targeting protein for Xklp2 ((TPX2) GI:8926138) {Homo sapiens}; similar to Restricted expression proliferation associated protein 100 (p100) (Differentially expressed in lung cells 2) (DIL-2) (Targeting protein for Xklp2) (C20orf1 protein) (C20orf2 protein) (Protein FLS353)(SP:Q9ULW0) {Homo sapiens} Length = 687 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/70 (20%), Positives = 32/70 (45%) Frame = +3 Query: 270 HTKGRGTRRTERFRHATSATFAHTQRKRHTIQDSKPVASVMAWSGISASQHTGATFAIPA 449 H + R R + F H S F+H ++++ S+ S++ W+ I ++ + + Sbjct: 617 HVEHRAVERAD-FDHKVSILFSHFSKQKNASITSEIDESILFWNQIKEKENQYKRYREES 675 Query: 450 TTGRRIQNLS 479 + + N+S Sbjct: 676 EAAKMVCNIS 685 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 28.3 bits (60), Expect = 5.1 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPP--SWRGPESLPRSTPVPPSQF 444 P P P P+ + +P PSP PP S P LP P PP + Sbjct: 50 PPPPSPPPPSCTPSP-PPPSPPPPKKSSCPPSPLPPPPPPPPPNY 93 Score = 27.5 bits (58), Expect = 9.0 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +1 Query: 319 LAPRSPIPNASATPFRTPSPLPPSWRGPE--SLPRSTPVPP 435 L + P P + P TPSP PPS P+ S P S P+PP Sbjct: 45 LQNQPPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPS-PLPP 84 >At4g36080.1 68417.m05136 FAT domain-containing protein / phosphatidylinositol 3- and 4-kinase family protein contains Pfam profiles PF00454: Phosphatidylinositol 3- and 4-kinase, PF02259: FAT domain, PF02260: FATC domain Length = 3839 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 163 VRGDIIAKIDDYDARDLRHEDAQNLFKNAP 252 ++GD K++D + +L + +A LFKN P Sbjct: 3057 LKGDFHLKLNDTEGANLAYSNAITLFKNLP 3086 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 27.9 bits (59), Expect = 6.8 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 7/56 (12%) Frame = +1 Query: 292 EGLRGSGTPLAPRSPIPNASAT-------PFRTPSPLPPSWRGPESLPRSTPVPPS 438 EG +P +P P P++S P + SP PP+ P+ +P PPS Sbjct: 3 EGQSPENSPPSPTPPSPSSSDNQQQSSPPPSDSSSPSPPAPPPPDDSSNGSPQPPS 58 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 27.9 bits (59), Expect = 6.8 Identities = 36/120 (30%), Positives = 54/120 (45%), Gaps = 9/120 (7%) Frame = +1 Query: 313 TPLAPRS-PIPNASATPFRTP---SPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYL 480 +PL+P S P ++ +P +P SPLPPS PE +P+ PS P++D Sbjct: 43 SPLSPSSSPEEDSPLSPSSSPEEDSPLPPS-SSPE---EDSPLAPSS-SPEVDSP----- 92 Query: 481 LSPSSTRTDETIDESIQSQPYRTTPL---VLPGAKVRREP--GPTESYLRHHPNPAMRAP 645 L+PSS+ ++ + S P +PL P A + P P L P+P P Sbjct: 93 LAPSSSPEVDS-PQPPSSSPEADSPLPPSSSPEANSPQSPASSPKPESLADSPSPPPPPP 151 Score = 27.9 bits (59), Expect = 6.8 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +1 Query: 307 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 453 S +P A SP+P +S+ +P P S PESL S PP QP+ Sbjct: 108 SSSPEAD-SPLPPSSSPEANSPQS-PASSPKPESLADSPSPPPPPPQPE 154 Score = 27.5 bits (58), Expect = 9.0 Identities = 22/66 (33%), Positives = 27/66 (40%), Gaps = 4/66 (6%) Frame = +1 Query: 307 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPE--SLPRSTPVP-PSQFQPQLDGEYRT- 474 + +P +P S S +P P PP P S P PVP PS D E T Sbjct: 125 ANSPQSPASSPKPESLADSPSPPPPPPQPESPSSPSYPEPAPVPAPSDDDSDDDPEPETE 184 Query: 475 YLLSPS 492 Y SP+ Sbjct: 185 YFPSPA 190 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +1 Query: 313 TPLAPRSPIPNASATPF--RTPSPLPPSWRGPESLPRSTPVPP 435 TP +P P S P+ +PSP P ++ P + S P PP Sbjct: 32 TPYSPLPPYVYNSPPPYVYNSPSPPPYVYKPPPYIYSSPPPPP 74 >At5g55310.1 68418.m06893 DNA topoisomerase I, putative similar to Swiss-Prot:P30181 DNA topoisomerase I [Arabidopsis thaliana] Length = 917 Score = 27.5 bits (58), Expect = 9.0 Identities = 35/142 (24%), Positives = 59/142 (41%), Gaps = 8/142 (5%) Frame = +1 Query: 190 DDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSG---TPLAP--RSPI--PNA 348 D Y+ D +D +FK N + +R S T +P RSP+ PN Sbjct: 16 DGYEDED--EDDIPLVFKRNSNTAATTNRPSPINNAMRNSAIGSTKSSPPMRSPLTSPNR 73 Query: 349 SATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRT-YLLSPSSTRTDETIDES 525 SA+ S + P+ S+ RST P + + + R + +PS +++D DE Sbjct: 74 SASSSTRSSMMKPALPSSSSVQRSTLKSPLRDDRSVVAKERNGFGKAPSVSKSD---DED 130 Query: 526 IQSQPYRTTPLVLPGAKVRREP 591 + + L L +V ++P Sbjct: 131 SEDDKPLSARLKLDSKEVTKQP 152 >At5g52680.1 68418.m06540 heavy-metal-associated domain-containing protein low similarity to pneumococcal surface protein A PspA [Streptococcus pneumoniae] GI:7800654; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 238 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 337 IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 438 I NA T R P+P+P R P P+ P PPS Sbjct: 174 INNARKTS-RVPAPVPV--RAPAPTPKPAPAPPS 204 >At5g16100.1 68418.m01881 hypothetical protein Length = 356 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = +1 Query: 406 SLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETIDESIQSQPYRTTPL 558 +LP ST VP S P D + LLSP + + ++ + TT L Sbjct: 282 TLPSSTDVPLSLLSPNEDHDVPLSLLSPEEALDIQPVPPHVELREEPTTRL 332 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +1 Query: 325 PRSPI-PNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 450 P SP+ P + P + P+ PP + P P +TPV P P Sbjct: 160 PTSPVKPPTTTPPVKPPTTTPPV-QPPTYNPPTTPVKPPTAPP 201 >At5g11510.1 68418.m01343 myb family transcription factor (MYB3R4) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 961 Score = 27.5 bits (58), Expect = 9.0 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = +1 Query: 355 TPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETI 516 TPFR P +W+ P + P P +F L E Y+ SP R+ E+I Sbjct: 835 TPFRRGLESPSAWKSPFYINSLLPSP--RFDTDLTIEDMGYIFSPGE-RSYESI 885 >At5g01040.1 68418.m00007 laccase family protein / diphenol oxidase family protein similar to laccase [Pinus taeda][GI:13661201], lac110 laccase, Populus trichocarpa, EMBL:PTY13773 Length = 584 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/51 (29%), Positives = 20/51 (39%) Frame = +1 Query: 292 EGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQF 444 +G S +P P P+PN +T R S + GP P V F Sbjct: 304 QGATSSSSPAEPLMPVPNDMSTAHRFTSNITSLVGGPHWTPVPRHVDEKMF 354 >At4g19570.1 68417.m02877 DNAJ heat shock N-terminal domain-containing protein low similarity to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 558 Score = 27.5 bits (58), Expect = 9.0 Identities = 22/86 (25%), Positives = 35/86 (40%), Gaps = 1/86 (1%) Frame = +1 Query: 199 DARDLRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSP 378 +A DL + +Q + + V QR + + S TP S P +S P P P Sbjct: 112 EAWDLLSDKSQRSSYDQKRKSNQVKQRTSGMQKPKRSSTPKPTESDKPASSYGPTPPPEP 171 Query: 379 LPPSWRGPESLPRSTPVP-PSQFQPQ 453 P P P+P P++ +P+ Sbjct: 172 RPKRRPRPNIPEPDIPMPMPTRHKPK 197 >At4g18760.1 68417.m02772 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611 Length = 431 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +1 Query: 331 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQ 447 S P+ S TP T SP+PP P S S+P+ P Q + Sbjct: 20 SAAPSLSPTPSPTTSPIPP--HKPSS--SSSPLDPKQLK 54 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 27.5 bits (58), Expect = 9.0 Identities = 17/62 (27%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Frame = +1 Query: 316 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPV-PPSQFQPQLDGEYRTYLLSPS 492 P +P P S P P+P W P S P P P + P E +++PS Sbjct: 73 PAPSFAPGPGPSFAPGPAPNPRSYDWLAPASSPNEPPAETPDESSPS-PSEETPSVVAPS 131 Query: 493 ST 498 + Sbjct: 132 QS 133 Score = 27.5 bits (58), Expect = 9.0 Identities = 22/66 (33%), Positives = 28/66 (42%), Gaps = 4/66 (6%) Frame = +1 Query: 412 PRSTPVPPSQFQPQLDGEYRTY-LLSPSSTRTD---ETIDESIQSQPYRTTPLVLPGAKV 579 P P P F P R+Y L+P+S+ + ET DES S T +V P V Sbjct: 75 PSFAPGPGPSFAPGPAPNPRSYDWLAPASSPNEPPAETPDESSPSPSEETPSVVAPSQSV 134 Query: 580 RREPGP 597 P P Sbjct: 135 PGPPRP 140 >At4g14990.1 68417.m02303 expressed protein Length = 787 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/54 (27%), Positives = 24/54 (44%) Frame = +1 Query: 484 SPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAP 645 S S RT + Q Q Y + P+++P + P P + + P+ RAP Sbjct: 151 SNSLYRTSSYPQQQTQLQHYSSEPIIVPESTFTSFPSPGKRSQQSSPSHIHRAP 204 >At3g44200.1 68416.m04739 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 941 Score = 27.5 bits (58), Expect = 9.0 Identities = 20/78 (25%), Positives = 33/78 (42%), Gaps = 4/78 (5%) Frame = +1 Query: 346 ASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDG----EYRTYLLSPSSTRTDET 513 A ++ +P+PPS +S PP P +D + R +SPS E Sbjct: 420 AHSSKTNASTPIPPSKLASDSARTPGSFPPKHHMPVIDSSPKLKPRNDRISPSPAAKHEA 479 Query: 514 IDESIQSQPYRTTPLVLP 567 +E++ + + TP LP Sbjct: 480 -EEAMSVKRRQRTPPTLP 496 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 307 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 438 S P P++P+ N S +P P P PS P L P PP+ Sbjct: 55 SEPPPPPKAPV-NVSLSP--PPPPRSPSTSTPPRLGNRNPPPPA 95 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 27.5 bits (58), Expect = 9.0 Identities = 27/117 (23%), Positives = 41/117 (35%), Gaps = 4/117 (3%) Frame = +1 Query: 310 GTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSP 489 G+ +A ++ P+ SP PP P +P PP + P Y + P Sbjct: 23 GSAMATEPYYYSSPPPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPP---PYYYHSPPP 79 Query: 490 SSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTES----YLRHHPNPAMRAPP 648 S P ++ P P P P +S Y H P P +++PP Sbjct: 80 PVKSPPPPYVYSSPPPPVKSPP---PPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPP 133 >At2g40760.1 68415.m05028 rhodanese-like domain-containing protein contains rhodanese-like domain PF00581 Length = 474 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = +1 Query: 241 KNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPI---PNASATPFRTPSPLPPSW 393 + + ++ IQRDV GLR TP++P ++S++P P W Sbjct: 153 RESVEEVLAFIQRDVRLNGLRQVETPVSPEQEAIHHGHSSSSPLAAGEDAPFRW 206 >At2g17930.1 68415.m02076 FAT domain-containing protein / phosphatidylinositol 3- and 4-kinase family protein contains Pfam profiles PF02259 FAT domain, PF00454 Phosphatidylinositol 3- and 4-kinase, PF02260: FATC domain Length = 3795 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +1 Query: 163 VRGDIIAKIDDYDARDLRHEDAQNLFKNAP 252 ++GD K++D ++ ++ + +A LFKN P Sbjct: 2984 LKGDFHLKLNDTESANIAYSNAITLFKNLP 3013 >At1g63570.1 68414.m07186 receptor-like protein kinase-related contains Pfam profile: PF01657 Domain of unknown function DUF26; similar to receptor-like protein kinase 4 (GI:13506745) [Arabidopsis thaliana] Length = 284 Score = 27.5 bits (58), Expect = 9.0 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = +1 Query: 331 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL 456 SP P+ S+ P P+ P+ P SLP P P SQ P L Sbjct: 246 SPAPSPSSLP-----PISPTSSPPLSLPPQLPPPLSQPPPPL 282 >At1g14920.1 68414.m01783 gibberellin response modulator (GAI) (RGA2) / gibberellin-responsive modulator identical to GAI GB:CAA75492 GI:2569938 [Arabidopsis thaliana] (Genes Dev. In press) Length = 533 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 469 RTYLLSPSSTRTDETIDESIQSQPYRTTP 555 R Y LSPS + D ++ +++Q Y T P Sbjct: 220 RIYRLSPSQSPIDHSLSDTLQMHFYETCP 248 >At1g12970.1 68414.m01506 leucine-rich repeat family protein Length = 464 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 595 PTESYLRHHPNPAMRAPPN 651 P SY+ HH +PA APP+ Sbjct: 9 PLLSYVLHHSDPASHAPPS 27 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.136 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,178,682 Number of Sequences: 28952 Number of extensions: 412298 Number of successful extensions: 2384 Number of sequences better than 10.0: 129 Number of HSP's better than 10.0 without gapping: 1531 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2107 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -