BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30835 (547 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB046843-1|BAB13449.2| 1236|Homo sapiens KIAA1623 protein protein. 30 4.6 Z11793-1|CAA77836.1| 381|Homo sapiens selenoprotein P protein. 30 6.1 DQ022288-1|AAY26400.1| 381|Homo sapiens selenoprotein P, plasma... 30 6.1 BC058919-1|AAH58919.1| 381|Homo sapiens selenoprotein P, plasma... 30 6.1 BC046152-1|AAH46152.1| 381|Homo sapiens selenoprotein P, plasma... 30 6.1 BC040075-1|AAH40075.1| 381|Homo sapiens selenoprotein P, plasma... 30 6.1 BC015875-1|AAH15875.1| 381|Homo sapiens selenoprotein P, plasma... 30 6.1 AK027869-1|BAB55419.1| 773|Homo sapiens protein ( Homo sapiens ... 29 8.0 >AB046843-1|BAB13449.2| 1236|Homo sapiens KIAA1623 protein protein. Length = 1236 Score = 30.3 bits (65), Expect = 4.6 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 433 QHEVR*RNDLQKRPRHVEHQQDRGHLGDGHDEGRS 537 Q + R R + ++R RH EH R H G +E R+ Sbjct: 902 QQQQRRRREEEERQRHAEHHARREHDSGGREEARA 936 >Z11793-1|CAA77836.1| 381|Homo sapiens selenoprotein P protein. Length = 381 Score = 29.9 bits (64), Expect = 6.1 Identities = 16/56 (28%), Positives = 23/56 (41%) Frame = -1 Query: 322 VQCGQEHTGADRRHDDVHLHLQTSNRTEGQHKSLRESVARLAPPVLDHCLAISGRH 155 V+ H + H+ H HL +S +E Q + APP L H G+H Sbjct: 198 VETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQH 253 >DQ022288-1|AAY26400.1| 381|Homo sapiens selenoprotein P, plasma, 1 protein. Length = 381 Score = 29.9 bits (64), Expect = 6.1 Identities = 16/56 (28%), Positives = 23/56 (41%) Frame = -1 Query: 322 VQCGQEHTGADRRHDDVHLHLQTSNRTEGQHKSLRESVARLAPPVLDHCLAISGRH 155 V+ H + H+ H HL +S +E Q + APP L H G+H Sbjct: 198 VETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQH 253 >BC058919-1|AAH58919.1| 381|Homo sapiens selenoprotein P, plasma, 1 protein. Length = 381 Score = 29.9 bits (64), Expect = 6.1 Identities = 16/56 (28%), Positives = 23/56 (41%) Frame = -1 Query: 322 VQCGQEHTGADRRHDDVHLHLQTSNRTEGQHKSLRESVARLAPPVLDHCLAISGRH 155 V+ H + H+ H HL +S +E Q + APP L H G+H Sbjct: 198 VETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNTPTHPAPPGLHHHHKHKGQH 253 >BC046152-1|AAH46152.1| 381|Homo sapiens selenoprotein P, plasma, 1 protein. Length = 381 Score = 29.9 bits (64), Expect = 6.1 Identities = 16/56 (28%), Positives = 23/56 (41%) Frame = -1 Query: 322 VQCGQEHTGADRRHDDVHLHLQTSNRTEGQHKSLRESVARLAPPVLDHCLAISGRH 155 V+ H + H+ H HL +S +E Q + APP L H G+H Sbjct: 198 VETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNTPTHPAPPGLHHHHKHKGQH 253 >BC040075-1|AAH40075.1| 381|Homo sapiens selenoprotein P, plasma, 1 protein. Length = 381 Score = 29.9 bits (64), Expect = 6.1 Identities = 16/56 (28%), Positives = 23/56 (41%) Frame = -1 Query: 322 VQCGQEHTGADRRHDDVHLHLQTSNRTEGQHKSLRESVARLAPPVLDHCLAISGRH 155 V+ H + H+ H HL +S +E Q + APP L H G+H Sbjct: 198 VETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQH 253 >BC015875-1|AAH15875.1| 381|Homo sapiens selenoprotein P, plasma, 1 protein. Length = 381 Score = 29.9 bits (64), Expect = 6.1 Identities = 16/56 (28%), Positives = 23/56 (41%) Frame = -1 Query: 322 VQCGQEHTGADRRHDDVHLHLQTSNRTEGQHKSLRESVARLAPPVLDHCLAISGRH 155 V+ H + H+ H HL +S +E Q + APP L H G+H Sbjct: 198 VETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQH 253 >AK027869-1|BAB55419.1| 773|Homo sapiens protein ( Homo sapiens cDNA FLJ14963 fis, clone PLACE4000522, weakly similar to NEUROGENIC LOCUS NOTCH PROTEIN. ). Length = 773 Score = 29.5 bits (63), Expect = 8.0 Identities = 28/90 (31%), Positives = 33/90 (36%), Gaps = 2/90 (2%) Frame = -1 Query: 379 HGGDT*APATSTTVLHHGHVQCGQEHTGADRRHDDVHLHLQTSNRTEGQHKSLRESVAR- 203 HG T P+ S + HH V G G+ R V + NR E E Sbjct: 514 HGASTVLPSVSQLLSHHHIVSPGSGSAGSLSRLHPVPVPADWMNRMEVNETQYNEMFGMV 573 Query: 202 LAPPVLDH-CLAISGRHHFAFHYTTSRKVL 116 LAP H LA R H TT R+ L Sbjct: 574 LAPAEGTHPGLAPQSRPPEGKHITTPREPL 603 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,522,020 Number of Sequences: 237096 Number of extensions: 1917602 Number of successful extensions: 4817 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 4588 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4816 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5364536570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -