SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV30826
         (849 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY337337-1|AAP94192.1|  505|Tribolium castaneum cytochrome P450 ...    23   4.0  
AF254755-1|AAF70496.1|  505|Tribolium castaneum cytochrome P450 ...    23   4.0  
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    21   9.3  
AM292322-1|CAL23134.1|  373|Tribolium castaneum gustatory recept...    21   9.3  

>AY337337-1|AAP94192.1|  505|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 505

 Score = 22.6 bits (46), Expect = 4.0
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = -1

Query: 714 IYMFNPRSFLSK 679
           IY+FNPR +L K
Sbjct: 231 IYVFNPRYYLEK 242


>AF254755-1|AAF70496.1|  505|Tribolium castaneum cytochrome P450
           monooxigenase CYP4Q7 protein.
          Length = 505

 Score = 22.6 bits (46), Expect = 4.0
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = -1

Query: 714 IYMFNPRSFLSK 679
           IY+FNPR +L K
Sbjct: 231 IYVFNPRYYLEK 242


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
            candidate 46 protein.
          Length = 1451

 Score = 21.4 bits (43), Expect = 9.3
 Identities = 8/34 (23%), Positives = 18/34 (52%)
 Frame = -1

Query: 801  YYIIQFYAIFFTDYISKRIRT*WRRYVQNIYMFN 700
            +Y+++FY +  +  +  +I T     +  I MF+
Sbjct: 1030 FYLVKFYKVSKSGELIHKIETNEHEIIDKIEMFS 1063


>AM292322-1|CAL23134.1|  373|Tribolium castaneum gustatory receptor
           candidate 1 protein.
          Length = 373

 Score = 21.4 bits (43), Expect = 9.3
 Identities = 8/34 (23%), Positives = 18/34 (52%)
 Frame = -1

Query: 801 YYIIQFYAIFFTDYISKRIRT*WRRYVQNIYMFN 700
           +Y+++FY +  +  +  +I T     +  I MF+
Sbjct: 311 FYLVKFYKVSKSGELIHKIETNEHEIIDKIEMFS 344


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 173,949
Number of Sequences: 336
Number of extensions: 3675
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 23451794
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -