BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30826 (849 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 27 0.22 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 3.6 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 4.7 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.22 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 425 RAPANTSWESGASALEHALKLESDVTNSI 511 R P SW S + + A KL+ ++ NSI Sbjct: 149 RTPTEASWHSPEAHISVAQKLQKEIPNSI 177 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.0 bits (47), Expect = 3.6 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = +1 Query: 403 RNRPHHVQGPRQHVVGERRISPRARPQAGE*RHQQHPGGHQDLREQLQRLPPG 561 +++P H Q H + +A+PQ + + QQ P Q ++Q Q+ G Sbjct: 806 QSQPPHQQ-LHHHQSTHPQAQAQAQPQQQQQQQQQQPQQQQQQQQQQQQQQRG 857 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.6 bits (46), Expect = 4.7 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 616 RRQGLDPQEDDGQARRPRRVHLRQETPRIEH 708 R+Q +DP + Q R RRV + + +E+ Sbjct: 96 RKQTIDPLSSNTQITRKRRVGIVENQYAVEN 126 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,195 Number of Sequences: 438 Number of extensions: 4424 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27309825 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -