BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30823 (805 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 4.4 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 23 4.4 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 22 5.8 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 5.8 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.6 bits (46), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 478 EKKRQAMLQAMKDASKTGPNFTIQKKSE 561 EKKRQA L + +A + G T ++ E Sbjct: 313 EKKRQAFLDLLIEAGQNGVLLTDKEVKE 340 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 22.6 bits (46), Expect = 4.4 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +1 Query: 445 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFG 570 I + +R++ EK +L + +AS PN + NFG Sbjct: 327 INTRGERIQLTEKNGIDVLGNIMEASILSPNQNVYGDLHNFG 368 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -1 Query: 292 AVCAIR*CIPSTVHP 248 A C I C P TVHP Sbjct: 357 AFCNIVSCSPQTVHP 371 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 5.8 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +2 Query: 710 LWGVHRQTRDREYDLEERQKKQDY 781 LWG+H+ D Y+ R + Y Sbjct: 499 LWGLHKNKPDMNYETMGRALRYYY 522 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.314 0.130 0.369 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,046 Number of Sequences: 438 Number of extensions: 2298 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25489170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -