BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30822 (755 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g23330.1 68414.m02917 expressed protein 30 1.9 At4g24460.1 68417.m03506 expressed protein 29 4.4 At2g21235.1 68415.m02522 bZIP protein-related similar to VirE2-i... 29 4.4 At2g17930.1 68415.m02076 FAT domain-containing protein / phospha... 29 4.4 At1g48560.1 68414.m05430 expressed protein 28 5.8 At1g28060.1 68414.m03435 small nuclear ribonucleoprotein family ... 28 7.7 >At1g23330.1 68414.m02917 expressed protein Length = 471 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = -2 Query: 166 AHQGTSRVELP-TEMSDGKSVQPSRCRWTCRADASCRSHSRIPWLMLVLSFGF 11 A GT+R + + DGKS++P C+ IPWL +FGF Sbjct: 206 ALNGTTRTYIDGIQPEDGKSLKPISLLQICKLGVIMYDWIDIPWLKSYYNFGF 258 >At4g24460.1 68417.m03506 expressed protein Length = 431 Score = 28.7 bits (61), Expect = 4.4 Identities = 18/58 (31%), Positives = 29/58 (50%) Frame = +2 Query: 572 TTPVRRPSPTVGHFTRSSASGDDVNLLSFYAKNRLAAAGLAVENATVKLLPWRPSRKF 745 T+P+RRP +VG T S+ + NL+ N + LAV N + L P +++ Sbjct: 68 TSPMRRPRFSVGASTEESSIPSNRNLI---VANSVVIVALAVANRVLYKLALVPMKQY 122 >At2g21235.1 68415.m02522 bZIP protein-related similar to VirE2-interacting protein VIP1 [Arabidopsis thaliana] GI:7258340, tbZIP transcription factor [Arabidopsis thaliana] GI:17065884 Length = 550 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +2 Query: 503 STIFPSITSQPRSSLDAATSRACTTPVRRPSPTVGHFTRSSAS 631 +++ P + P S D + CTT +PSPT FT++S S Sbjct: 32 TSLSPPLIRYPAGSPDFSPGPRCTT---QPSPTFSDFTQASPS 71 >At2g17930.1 68415.m02076 FAT domain-containing protein / phosphatidylinositol 3- and 4-kinase family protein contains Pfam profiles PF02259 FAT domain, PF00454 Phosphatidylinositol 3- and 4-kinase, PF02260: FATC domain Length = 3795 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -1 Query: 569 THARLPRPVNFLADS**KERLWMLSATLRRGTKSLAM 459 THA LPRP F ++ +W S L+ G LA+ Sbjct: 450 THAHLPRPQGFKGMR--EDEVWKASGVLKSGVHCLAL 484 >At1g48560.1 68414.m05430 expressed protein Length = 643 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +2 Query: 524 TSQPRSSLDAATSRACTTPVRRP-SPTVGHFTRS 622 T PR+S +++T +AC T VRR GH ++S Sbjct: 236 TRSPRTSSNSSTMKACETMVRRAVHEDDGHLSKS 269 >At1g28060.1 68414.m03435 small nuclear ribonucleoprotein family protein / snRNP family protein contains similarity to U4/U6 small nuclear ribonucleoprotein hPrp3 [Homo sapiens] gi|2708307|gb|AAC51926 Length = 786 Score = 27.9 bits (59), Expect = 7.7 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +2 Query: 182 GSGSAHPWSSVSWTESLTDAAQHWPSLPSMTSCAPKQPRLSKMRPV 319 GSG+ +P S V T A + S+PS S AP Q L+K+ + Sbjct: 147 GSGATNPTSGV------TMGASTYSSIPSEASAAPSQTLLTKVSSI 186 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,027,720 Number of Sequences: 28952 Number of extensions: 335227 Number of successful extensions: 1001 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 971 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1001 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1682736544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -