Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV30818
         (734 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_06_0161 + 32093701-32094302,32094413-32094689                       28   8.8  

>03_06_0161 + 32093701-32094302,32094413-32094689
          Length = 292

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
 Frame = -3

Query: 471 LCLTNRIVLFYFFSNYSLKAFM-K*PLKHTYIYLFLIIVFMNTILYPQVCTNLSYSFTSF 295
           L LT  +    F   YSL++   K      +I LF+I++   +    Q+CTNLS S +S 
Sbjct: 197 LVLTRTVCSANFDVGYSLRSVCNKDKDSIHFILLFVIVIISESKFTLQMCTNLS-SLSSE 255

Query: 294 NLGDD*K*LYRG 259
            L      L+RG
Sbjct: 256 FLQSPITPLFRG 267


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,508,921
Number of Sequences: 37544
Number of extensions: 324966
Number of successful extensions: 470
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 464
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 470
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1933531792
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)