BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30818 (734 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0161 + 32093701-32094302,32094413-32094689 28 8.8 >03_06_0161 + 32093701-32094302,32094413-32094689 Length = 292 Score = 27.9 bits (59), Expect = 8.8 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Frame = -3 Query: 471 LCLTNRIVLFYFFSNYSLKAFM-K*PLKHTYIYLFLIIVFMNTILYPQVCTNLSYSFTSF 295 L LT + F YSL++ K +I LF+I++ + Q+CTNLS S +S Sbjct: 197 LVLTRTVCSANFDVGYSLRSVCNKDKDSIHFILLFVIVIISESKFTLQMCTNLS-SLSSE 255 Query: 294 NLGDD*K*LYRG 259 L L+RG Sbjct: 256 FLQSPITPLFRG 267 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,508,921 Number of Sequences: 37544 Number of extensions: 324966 Number of successful extensions: 470 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 470 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1933531792 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -