BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30818 (734 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY118724-1|AAM50584.1| 570|Drosophila melanogaster GH02014p pro... 31 2.2 AE014297-3518|AAF56273.2| 570|Drosophila melanogaster CG6356-PA... 31 2.2 >AY118724-1|AAM50584.1| 570|Drosophila melanogaster GH02014p protein. Length = 570 Score = 30.7 bits (66), Expect = 2.2 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = -1 Query: 224 VIKVPFYLVLVVLVRFAGHLKLTLLFHTPTKILIINAPATGVGSPTLI 81 ++ +P YLV V+++RF G T+ T + ++ A GS T I Sbjct: 414 LVDIPSYLVPVIMLRFTGRRLTTMFLFLWTGVSLLLVLAVPAGSTTWI 461 >AE014297-3518|AAF56273.2| 570|Drosophila melanogaster CG6356-PA protein. Length = 570 Score = 30.7 bits (66), Expect = 2.2 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = -1 Query: 224 VIKVPFYLVLVVLVRFAGHLKLTLLFHTPTKILIINAPATGVGSPTLI 81 ++ +P YLV V+++RF G T+ T + ++ A GS T I Sbjct: 414 LVDIPSYLVPVIMLRFTGRRLTTMFLFLWTGVSLLLVLAVPAGSTTWI 461 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,694,390 Number of Sequences: 53049 Number of extensions: 601682 Number of successful extensions: 883 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 868 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 883 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3314233461 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -