BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30818 (734 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF067949-7|AAO25995.2| 626|Caenorhabditis elegans Peroxisomal m... 28 7.9 >AF067949-7|AAO25995.2| 626|Caenorhabditis elegans Peroxisomal membrane protein relatedprotein 5, isoform b protein. Length = 626 Score = 27.9 bits (59), Expect = 7.9 Identities = 18/69 (26%), Positives = 37/69 (53%), Gaps = 9/69 (13%) Frame = -1 Query: 248 INTRHLSF---------VIKVPFYLVLVVLVRFAGHLKLTLLFHTPTKILIINAPATGVG 96 I T HLSF +I++ +++ V+++ +G+ LT FH P ++ +G+G Sbjct: 390 IETEHLSFGPPTNSNIRIIEMGGFMIFVLILFQSGYTDLT--FHLPRNKTLLITGDSGIG 447 Query: 95 SPTLI*ILA 69 +L+ ++A Sbjct: 448 KTSLMRVIA 456 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,476,960 Number of Sequences: 27780 Number of extensions: 346713 Number of successful extensions: 768 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 768 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1724918872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -