BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30811 (449 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 24 0.76 AM295016-1|CAL25731.1| 96|Tribolium castaneum ecdysone recepto... 23 1.3 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 3.1 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 4.0 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 5.4 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 23.8 bits (49), Expect = 0.76 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 82 YFILMFVNSFLWIV 41 Y I +FVN F W++ Sbjct: 96 YLIFIFVNVFFWVI 109 >AM295016-1|CAL25731.1| 96|Tribolium castaneum ecdysone receptor (isoform B) protein. Length = 96 Score = 23.0 bits (47), Expect = 1.3 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +1 Query: 115 WRLVLGMSDHPRDRTICRGSY 177 W L L +HPR TI + Y Sbjct: 45 WDLDLNAQNHPRGLTIIQNGY 65 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 3.1 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 2 LTFICLKLVLLTLYY 46 L F C+ ++LL +YY Sbjct: 226 LLFYCVLIILLCIYY 240 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 4.0 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +1 Query: 373 YNYYNMTILGHLEGGPGTQ 429 Y Y+M +L + GG G + Sbjct: 1170 YTNYSMEVLAYTSGGDGVR 1188 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.0 bits (42), Expect = 5.4 Identities = 11/47 (23%), Positives = 22/47 (46%) Frame = +1 Query: 103 NTPHWRLVLGMSDHPRDRTICRGSYMFTLFIDNNLNLHFLHTSIEDL 243 N PH +L + + ++ +C F L + N + F+ ++E L Sbjct: 89 NHPHIQLPKHVDQYLLEQLVCEQLGGFLLILTPNGKIVFVSHTVEHL 135 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,172 Number of Sequences: 336 Number of extensions: 2368 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -