BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30811 (449 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyce... 25 4.1 SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pomb... 25 5.4 SPCC74.09 |mug24||RNA-binding protein, rrm type|Schizosaccharomy... 25 7.1 SPBC56F2.01 |pof12||F-box protein Pof12|Schizosaccharomyces pomb... 24 9.4 >SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1610 Score = 25.4 bits (53), Expect = 4.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 376 YKIISMLVNLPNIRCNACR 320 Y ++S+ LPN RC CR Sbjct: 1562 YSVLSVERTLPNKRCGTCR 1580 >SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 2386 Score = 25.0 bits (52), Expect = 5.4 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 160 ICRGSYMFTLFIDNNLNLHFLH 225 IC G TLF ++ LNL LH Sbjct: 398 ICTGKLENTLFSNSELNLFLLH 419 >SPCC74.09 |mug24||RNA-binding protein, rrm type|Schizosaccharomyces pombe|chr 3|||Manual Length = 654 Score = 24.6 bits (51), Expect = 7.1 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -2 Query: 181 TCSYLCKLFDP*DGHSFLKRVSNEEC 104 T + +C L D D +S L V N EC Sbjct: 45 TANSICTLNDSEDDNSSLNSVDNNEC 70 >SPBC56F2.01 |pof12||F-box protein Pof12|Schizosaccharomyces pombe|chr 2|||Manual Length = 440 Score = 24.2 bits (50), Expect = 9.4 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 136 SDHPRDRTICRGSYMFTLFIDNNLNLHFLHTSIEDLK 246 S P GSY+ T DN+L L L+++ +L+ Sbjct: 305 SQQPASAIFMYGSYILTSHPDNSLILQRLYSTNNELR 341 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,883,987 Number of Sequences: 5004 Number of extensions: 37187 Number of successful extensions: 53 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 166231220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -