BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30808 (725 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0306 + 16176873-16177124,16178155-16179152,16179204-161793... 29 2.8 07_01_0686 - 5184061-5184267,5184655-5184762,5185405-5185578,518... 29 2.8 02_03_0134 - 15596379-15597689 29 2.8 06_03_0403 - 20435349-20435358,20435750-20436204,20436744-20438315 29 3.8 03_02_0243 - 6744164-6744415,6744518-6745135 29 5.0 02_05_0008 + 24934917-24935229,24936387-24936608,24936876-249375... 29 5.0 09_03_0177 - 13120816-13120941,13121032-13121137,13121231-131213... 28 6.6 01_03_0216 + 13870364-13870472,13871406-13871477,13871603-138716... 28 8.7 >11_04_0306 + 16176873-16177124,16178155-16179152,16179204-16179339, 16179448-16179597,16179711-16179891,16181139-16181298, 16182156-16182378 Length = 699 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 79 HSSNTSSKVTSRPSTKKLICTVAKQSTLWATTGRRTPIY 195 H TS+ + PSTK L+C+ +Q+ L + R P+Y Sbjct: 583 HLDTTSTSINLHPSTKLLLCS-QEQAGLKFSLSRACPLY 620 >07_01_0686 - 5184061-5184267,5184655-5184762,5185405-5185578, 5185680-5185808,5185891-5186178,5186341-5186570, 5186619-5187516 Length = 677 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -1 Query: 602 NCHSERLVV-KTWLTDLVTVRRALEFFFTEVDGVEGIEVEMVKECDHFVD 456 N +ER+ V KTW++ + + FF + G + + VE+ KE + F D Sbjct: 442 NHFAERMGVRKTWMSAVRNSPNVVARFFVALHGRKEVNVELKKEAEFFGD 491 >02_03_0134 - 15596379-15597689 Length = 436 Score = 29.5 bits (63), Expect = 2.8 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = +1 Query: 28 TARRTTKKFASSTFMRRHSSNTSSKVTSRPSTKKLICTVAKQSTLWATTG 177 TAR + K + T + S+ S ++SRP K+ + AKQ T AT G Sbjct: 121 TARNRSSKDMNRT-AKSSSAMQKSNLSSRPGVDKMAASSAKQRTQKATPG 169 >06_03_0403 - 20435349-20435358,20435750-20436204,20436744-20438315 Length = 678 Score = 29.1 bits (62), Expect = 3.8 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +1 Query: 82 SSNTSSKVTSRPSTKKLICTVAKQSTLWATTGRRTPIYSKKTSSNSTSV 228 +S ++S ++RP+T CT A T +P +K+TSS S+SV Sbjct: 635 ASRSASPTSARPATSSWTCTS-------AATASASPATAKRTSSTSSSV 676 >03_02_0243 - 6744164-6744415,6744518-6745135 Length = 289 Score = 28.7 bits (61), Expect = 5.0 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 638 DDGVSGNIRFNINCHSERLVV 576 D VSG+ RF++ C ERLVV Sbjct: 87 DVRVSGSARFDVQCRGERLVV 107 >02_05_0008 + 24934917-24935229,24936387-24936608,24936876-24937591, 24937646-24937728,24938448-24938514,24938833-24939228, 24939276-24939318,24939380-24939474,24940287-24940314, 24940636-24940754 Length = 693 Score = 28.7 bits (61), Expect = 5.0 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = -1 Query: 518 EVDGVEGIEVEMVKECDHFVDFDVGNFQTNEVKSFLCVWYLVLFKF 381 E+ ++ EV ++K C F F + Q + +LC+ ++VL + Sbjct: 409 ELSRLDNPEVSLIKACLVFTTFSMALVQKCRLTQYLCLVFIVLVDY 454 >09_03_0177 - 13120816-13120941,13121032-13121137,13121231-13121305, 13121385-13121461,13122462-13122549,13122638-13122699, 13122807-13122863,13122960-13123049,13123186-13123251, 13123530-13123619,13123711-13123804,13123915-13124213 Length = 409 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +3 Query: 339 AFYQLYKRIVQYIIEFKQYQVPYTQEALHFVGLKI 443 A+ K ++ EF+ ++ P+ EA+H V L+I Sbjct: 91 AYSSFEKAANAFLQEFRNWETPWAMEAMHTVALEI 125 >01_03_0216 + 13870364-13870472,13871406-13871477,13871603-13871668, 13871767-13871823,13871917-13871984,13872068-13872149, 13872445-13872500,13872645-13872947,13873042-13873128, 13873199-13873373,13873481-13873602,13873689-13873852, 13873925-13874179,13874312-13874433,13874542-13874663, 13875111-13875259,13875346-13875484,13875715-13875750 Length = 727 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 402 PYTQEALHFVGLKISDVKVDKMVTFF 479 PYTQ AL FV L + K+D+ T F Sbjct: 506 PYTQSALLFVDLGMDVYKIDRACTKF 531 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,407,781 Number of Sequences: 37544 Number of extensions: 313494 Number of successful extensions: 850 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 831 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 850 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1898162308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -