BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30806 (844 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) 99 7e-36 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 31 1.5 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) 25 2.5 SB_8527| Best HMM Match : zf-C2H2 (HMM E-Value=4.3e-21) 30 2.7 SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) 29 4.7 SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_59380| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_1052| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) 28 8.2 >SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) Length = 710 Score = 98.7 bits (235), Expect(2) = 7e-36 Identities = 43/60 (71%), Positives = 51/60 (85%) Frame = +1 Query: 43 TTMGDIEDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKV 222 T ++ DT F +G+SGAS T+P QCS+LRKNG V++KGRPCKIVEMSTSKTGKHGHAKV Sbjct: 585 TMAEELADTEFHSGESGASDTYPAQCSSLRKNGHVVIKGRPCKIVEMSTSKTGKHGHAKV 644 Score = 70.5 bits (165), Expect(2) = 7e-36 Identities = 29/62 (46%), Positives = 44/62 (70%) Frame = +1 Query: 322 QLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLRTDFDSGKELLCTVLKSCGEECVIA 501 ++T+I +DGYL LM DNGD R D+K+ D D+ ++R F++ + + TVLK+ GEE V+ Sbjct: 643 KVTNIEEDGYLELMDDNGDTRADIKLQDNDIAKEIRAKFEASENFMVTVLKAMGEETVVG 702 Query: 502 VK 507 VK Sbjct: 703 VK 704 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 8 HEXFLTVVKFKTQQWVTSKTHTSRPETPGPQPPSPCNVRPC 130 H L K KT + T+K +T++P T P+ P +PC Sbjct: 92 HTIKLYTTKPKTTKPHTNKPYTTKPRTTKPRTTKPHTTKPC 132 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +2 Query: 56 TSKTHTSRPETPGPQPPSPCNVRPCVKTVSLC*RVVH-ARLLKCPH 190 T+K HT++P T P P N+ P + + +L ++H + PH Sbjct: 168 TTKPHTTKPHTTKPHTTKPHNIDPTLPSPTLLNALLHFLYFYQAPH 213 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/52 (36%), Positives = 25/52 (48%) Frame = +2 Query: 44 QQWVTSKTHTSRPETPGPQPPSPCNVRPCVKTVSLC*RVVHARLLKCPHPKP 199 +Q V S P P P PP+PC + PC +T +VVH+ L P P Sbjct: 126 EQHVVSHVMHPAPPPPPPPPPAPC-MPPCHQT-----QVVHSVQLHASPPGP 171 >SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) Length = 458 Score = 24.6 bits (51), Expect(2) = 2.5 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +2 Query: 107 SPCNVRPCVKTVSLC*RVVHARLLKCPHPKPESTATLKFTWLGLISSMVKSMK 265 +PC ++ C + +S+ V ++K P P TL ++G + +K +K Sbjct: 398 NPCRIQYCTQEISMTPIHVLLLIVKAPILDPSLVVTLCSRFIGHQARKLKIVK 450 Score = 23.8 bits (49), Expect(2) = 2.5 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 89 PGPQPPSPCNVRP 127 PGPQ P P N+ P Sbjct: 362 PGPQDPGPGNILP 374 >SB_8527| Best HMM Match : zf-C2H2 (HMM E-Value=4.3e-21) Length = 1049 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/70 (27%), Positives = 31/70 (44%), Gaps = 3/70 (4%) Frame = -3 Query: 554 NPINAELVYLSRAVF---ALTAMTHSSPQDFSTVHNNSLPLSKSVRNCVPRSPSGILRSS 384 NP L Y + A+F + A S QD+ +H NS + N +P+ S I ++ Sbjct: 69 NPSFGPLNYATMAIFPPNTVPAPPQDSTQDYREIHTNSFYFQHQMSNTLPKEES-IQQAD 127 Query: 383 RRSPLSAIRV 354 +P + V Sbjct: 128 ESAPHDILSV 137 >SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) Length = 1058 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 23 TVVKFKTQQWVTSKTHTSRPETPGPQPPSPCNVRP 127 +VV + VT K T +P TP P P P RP Sbjct: 758 SVVAMPAARPVTPKPVTPKPVTPKPVTPKPVTTRP 792 >SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +1 Query: 133 KNGFVMLKGRPCKIV-EMSTSKTGKHGHAKVHLVGIDIFNG 252 + G +M +G+PCKI + K G HG +H+ G D NG Sbjct: 17 RRGVMMAEGKPCKITGTIEGLKAGNHGF-HIHVYG-DNTNG 55 >SB_59380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1226 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -1 Query: 754 GLRARLRNASAK*GGEVLRVTSARGR 677 G R+R+AS K GGE + + SA GR Sbjct: 334 GCNLRIRSASPKDGGEYMCIVSASGR 359 >SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1671 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +1 Query: 247 NGKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNG 375 NG Y CP N D + EDY + D YLT D G Sbjct: 400 NGHTYHMTCPGQTNFDPAKKRCEDYDCSG-RDVAYLTDQNDGG 441 >SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1438 Score = 28.7 bits (61), Expect = 6.2 Identities = 21/84 (25%), Positives = 37/84 (44%) Frame = +1 Query: 274 PSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLRTDFDSGKE 453 P + + V + +++ D + ADN + RE+ + +L ++ T G Sbjct: 284 PESDGIRVDETENGEHEAVDELPEDKPDTEADNYEQREETPTKEDELKSECTTSDSEGTP 343 Query: 454 LLCTVLKSCGEECVIAVKANTALD 525 T KS GEE V A ++ +LD Sbjct: 344 SAATYGKSDGEENV-AQESEESLD 366 >SB_1052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1092 Score = 28.7 bits (61), Expect = 6.2 Identities = 30/131 (22%), Positives = 53/131 (40%), Gaps = 8/131 (6%) Frame = +1 Query: 67 THFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKT-----GKHGHAKVHLV 231 T E+G + P QC+ + F+ RP + + S ++ G + L Sbjct: 865 TRRESGQRVSHGLSPKQCAVSVVSSFMDSGARPRRFLPGSQARPRRFLPGSQPRPRRFLP 924 Query: 232 GIDIFNGKKYE--DICPSTHNMDVPHVKREDYQLTDISD-DGYLTLMADNGDLREDLKIP 402 + + G Y ++ P +D+ + Y++ ++ D YL L D GD LK+ Sbjct: 925 VLKLDPGDFYRVLNLDPGDFYLDLKLDPGDFYRVLNLDPGDFYLDLKLDPGDFYPVLKLD 984 Query: 403 DGDLGTQLRTD 435 GD L+ D Sbjct: 985 PGDFYPVLKRD 995 >SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) Length = 492 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = -3 Query: 482 PQDFSTVHNNSLPLSKSVRNCVPRSPSGILRSSRRSPLSAIRVR 351 P+ S V + +LP+ V C+P SPS I RS P VR Sbjct: 253 PRQISNVRSLTLPVRYQVIGCLP-SPSDIKRSVPYPPRQISNVR 295 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,994,186 Number of Sequences: 59808 Number of extensions: 560664 Number of successful extensions: 1628 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1614 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2383424791 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -