BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30805 (789 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 25 0.91 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 23 3.7 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 23 3.7 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 22 4.9 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 8.5 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 8.5 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 24.6 bits (51), Expect = 0.91 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 563 DGLISIICQSVSADTLTCTIENGGML 640 DG I +C S+ DTL C G +L Sbjct: 218 DGSIVFVCFSLVEDTLPCVFFLGSIL 243 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 447 VSPFFSSTSAEPPPSKSP 394 +SP + A PPP++SP Sbjct: 106 LSPQIQTQVARPPPARSP 123 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 447 VSPFFSSTSAEPPPSKSP 394 +SP + A PPP++SP Sbjct: 106 LSPQIQTQVARPPPARSP 123 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +3 Query: 696 PRRTSRTCSSASN 734 P+RT+ T SSASN Sbjct: 203 PQRTASTASSASN 215 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -1 Query: 270 EPCEKFILATFIPVSIIFSSTATLRDAGPIVQII 169 +P + + T++PV I S +D P++ +I Sbjct: 468 QPYDSLLWHTWMPVMRICVSAWNPKDCDPLITLI 501 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 423 SAEPPPSKSPVLISGPLVS 367 SA+P PS+SP I P+ + Sbjct: 337 SAQPTPSQSPNQIYQPVTN 355 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,074 Number of Sequences: 336 Number of extensions: 3850 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21376414 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -