BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30803 (703 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 24 5.3 AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 23 9.3 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 23.8 bits (49), Expect = 5.3 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -2 Query: 285 VFATDVNCNFMEFSSILCFF 226 ++ ++ C F FSS LC F Sbjct: 185 IYIQEICCRFFTFSSSLCCF 204 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 23.0 bits (47), Expect = 9.3 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = -2 Query: 120 ATKLETIHLSNRPPFPQKEIYSSSEHS*SPVKKKKNSRLV 1 AT T+ P PQ ++++ +S KKK SR + Sbjct: 58 ATYANTVSAKTVAPTPQAASHTAAGNSGQKKKKKSRSRFL 97 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 654,242 Number of Sequences: 2352 Number of extensions: 12169 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -