BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30803 (703 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY071071-1|AAL48693.1| 68|Drosophila melanogaster RE14453p pro... 32 0.66 AF145655-1|AAD38630.1| 667|Drosophila melanogaster BcDNA.GH0914... 32 0.87 AE013599-297|AAF59298.1| 667|Drosophila melanogaster CG4445-PA ... 32 0.87 AE014298-237|AAF45648.1| 724|Drosophila melanogaster CG11491-PE... 30 3.5 BT023949-1|ABB36453.1| 1312|Drosophila melanogaster IP03879p pro... 29 4.6 AE014298-2334|AAF48566.2| 1311|Drosophila melanogaster CG32577-P... 29 4.6 BT030441-1|ABO52861.1| 759|Drosophila melanogaster RE42355p pro... 29 8.1 AE014134-312|ABI31282.1| 2347|Drosophila melanogaster CG7337-PC,... 29 8.1 >AY071071-1|AAL48693.1| 68|Drosophila melanogaster RE14453p protein. Length = 68 Score = 32.3 bits (70), Expect = 0.66 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -1 Query: 250 IFIYFMLFLYFMCLKSYIK 194 I+I+FM FLY +CL Y+K Sbjct: 8 IYIFFMFFLYILCLSLYVK 26 >AF145655-1|AAD38630.1| 667|Drosophila melanogaster BcDNA.GH09147 protein. Length = 667 Score = 31.9 bits (69), Expect = 0.87 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = -3 Query: 284 FSQLMLIAILWNFHLFYAFFIFYVS*ILY*ILTINRIDQKSKH 156 F QL + +L+ F LF+AFF+F +S LY + +I D + +H Sbjct: 5 FQQLKKLWLLYLFLLFFAFFMFAISINLY-VASIQGGDAEMRH 46 >AE013599-297|AAF59298.1| 667|Drosophila melanogaster CG4445-PA protein. Length = 667 Score = 31.9 bits (69), Expect = 0.87 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = -3 Query: 284 FSQLMLIAILWNFHLFYAFFIFYVS*ILY*ILTINRIDQKSKH 156 F QL + +L+ F LF+AFF+F +S LY + +I D + +H Sbjct: 5 FQQLKKLWLLYLFLLFFAFFMFAISINLY-VASIQGGDAEMRH 46 >AE014298-237|AAF45648.1| 724|Drosophila melanogaster CG11491-PE, isoform E protein. Length = 724 Score = 29.9 bits (64), Expect = 3.5 Identities = 27/82 (32%), Positives = 35/82 (42%) Frame = -1 Query: 703 SSVNNVIYQHFNNFNT*VYAPY*HFRYQNQPYNTQQTLIATPYFDGYLPLICITSASKI* 524 +++NN I + NN N P + Q P T TL TP ITSAS I Sbjct: 443 TTINNSITNNNNNNNYDYSLPTKNSNSQKTPSPTTTTL-TTPTTTTPTRPTAITSASGIC 501 Query: 523 GIRFVNLIANISIRS*NNGCMS 458 G+ AN S +NG +S Sbjct: 502 GLNLSTFAANGSSSGGSNGGLS 523 >BT023949-1|ABB36453.1| 1312|Drosophila melanogaster IP03879p protein. Length = 1312 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/50 (32%), Positives = 20/50 (40%) Frame = -2 Query: 180 SNRPKIKTQLNI*TEVKLRPATKLETIHLSNRPPFPQKEIYSSSEHS*SP 31 +N +NI V+L LE L R P P+ EI EH P Sbjct: 959 NNNNNNNNNININNSVRLESDNGLEASELEEREPEPETEIEPEHEHEHEP 1008 >AE014298-2334|AAF48566.2| 1311|Drosophila melanogaster CG32577-PA protein. Length = 1311 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/50 (32%), Positives = 20/50 (40%) Frame = -2 Query: 180 SNRPKIKTQLNI*TEVKLRPATKLETIHLSNRPPFPQKEIYSSSEHS*SP 31 +N +NI V+L LE L R P P+ EI EH P Sbjct: 958 NNNNNNNNNININNSVRLESDNGLEASELEEREPEPETEIEPEHEHEHEP 1007 >BT030441-1|ABO52861.1| 759|Drosophila melanogaster RE42355p protein. Length = 759 Score = 28.7 bits (61), Expect = 8.1 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 183 KSNRPKIKTQLNI*TEVKLRPATKLETIHLSNRPP 79 + NRPKI + N +++K P+ K E PP Sbjct: 181 QKNRPKISVRFNTVSQIKYTPSAKRERQAREEEPP 215 >AE014134-312|ABI31282.1| 2347|Drosophila melanogaster CG7337-PC, isoform C protein. Length = 2347 Score = 28.7 bits (61), Expect = 8.1 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 183 KSNRPKIKTQLNI*TEVKLRPATKLETIHLSNRPP 79 + NRPKI + N +++K P+ K E PP Sbjct: 1769 QKNRPKISVRFNTVSQIKYTPSAKRERQAREEEPP 1803 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,010,225 Number of Sequences: 53049 Number of extensions: 511223 Number of successful extensions: 911 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 867 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 909 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3087795150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -