BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30800 (765 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large subunit|... 29 0.73 SPBC6B1.02 |ppk30||Ark1/Prk1 family protein kinase Ppk30|Schizos... 28 1.3 SPCC1235.05c |fft2||fun thirty related protein Fft2|Schizosaccha... 27 2.2 SPAC2F7.09c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 27 2.9 SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces... 27 3.9 SPAC1A6.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||... 26 6.8 SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1... 26 6.8 SPBPB2B2.11 |||nucleotide-sugar 4,6-dehydratase |Schizosaccharom... 25 9.0 >SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 1752 Score = 29.1 bits (62), Expect = 0.73 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +2 Query: 392 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 493 S+S TSP P S +Y A Y PT + PTSP Sbjct: 1591 SYSPTSPSYSPTSPSYSATSPSYSPTSPSYSPTSP 1625 Score = 27.5 bits (58), Expect = 2.2 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 392 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 493 S+S TSP P S +Y Y PT + PTSP Sbjct: 1605 SYSATSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1639 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 392 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 493 S+S TSP P S +Y Y PT + PTSP Sbjct: 1612 SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1646 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 392 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 493 S+S TSP P S +Y Y PT + PTSP Sbjct: 1619 SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1653 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 392 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 493 S+S TSP P S +Y Y PT + PTSP Sbjct: 1626 SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1660 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 392 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 493 S+S TSP P S +Y Y PT + PTSP Sbjct: 1633 SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1667 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 392 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 493 S+S TSP P S +Y Y PT + PTSP Sbjct: 1640 SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1674 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 392 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 493 S+S TSP P S +Y Y PT + PTSP Sbjct: 1647 SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1681 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 392 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 493 S+S TSP P S +Y Y PT + PTSP Sbjct: 1654 SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1688 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 392 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 493 S+S TSP P S +Y Y PT + PTSP Sbjct: 1661 SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1695 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 392 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 493 S+S TSP P S +Y Y PT + PTSP Sbjct: 1668 SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1702 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 392 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 493 S+S TSP P S +Y Y PT + PTSP Sbjct: 1675 SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1709 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 392 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 493 S+S TSP P S +Y Y PT + PTSP Sbjct: 1682 SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1716 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 392 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 493 S+S TSP P S +Y Y PT + PTSP Sbjct: 1689 SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1723 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 392 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 493 S+S TSP P S +Y Y PT + PTSP Sbjct: 1696 SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1730 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 392 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 493 S+S TSP P S +Y Y PT + PTSP Sbjct: 1703 SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1737 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 392 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 493 S+S TSP P S +Y Y PT + PTSP Sbjct: 1710 SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1744 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 392 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 493 S+S TSP P S +Y Y PT + PTSP Sbjct: 1717 SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1751 Score = 25.4 bits (53), Expect = 9.0 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 6/34 (17%) Frame = +3 Query: 375 PSLHRAHSPGHLLKVFP------SASITSPTRTD 458 PSLH+ GH ++V P + S+TSP D Sbjct: 454 PSLHKMSMMGHRIRVMPYSTFRLNLSVTSPYNAD 487 >SPBC6B1.02 |ppk30||Ark1/Prk1 family protein kinase Ppk30|Schizosaccharomyces pombe|chr 2|||Manual Length = 953 Score = 28.3 bits (60), Expect = 1.3 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = +3 Query: 354 VETPLLFPSLHRAHSPGHLLKV--FPSASITSPTRTDTSPLVMLSPLP 491 ++TP PSL RA S H++KV P S+ + +T S + +LS P Sbjct: 439 IQTPRS-PSLRRADSTSHIIKVPHLPDTSVKT-AKTGASEIDVLSRYP 484 >SPCC1235.05c |fft2||fun thirty related protein Fft2|Schizosaccharomyces pombe|chr 3|||Manual Length = 1284 Score = 27.5 bits (58), Expect = 2.2 Identities = 30/104 (28%), Positives = 45/104 (43%), Gaps = 8/104 (7%) Frame = +2 Query: 200 APVRVVPKVSEGYGAETVKFGNEINPDGSYTYFYETNNGIAAQEQGVPRNLGGNPPAVPV 379 AP + Y ++ + NP SY N GI A G+P G P VP Sbjct: 99 APAAINNNFGYSYVGQSSQPVPSYNPLPSYNTASLPNAGIPAAMPGMP---SGYPGTVP- 154 Query: 380 VAQGSFS--WTSP--EGVPI-SVN---YVADENGYQPTGNAIPT 487 + QG ++ ++SP G PI +VN + + QP N +P+ Sbjct: 155 IPQGGYNAHYSSPYNNGYPIGAVNPTSAIPAQPPAQPVNNVLPS 198 >SPAC2F7.09c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 491 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +3 Query: 399 PGHLLKVFPSASITSPTRTDTSPLVMLSPLP-HQCLSRSLVLLPTSPRTF 545 P H+ + S+ + T+ D PLV SP P H + S+ S F Sbjct: 392 PAHITSITKLQSLENSTKNDNVPLVTHSPSPMHSSFTVSIKPTQLSENVF 441 >SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces pombe|chr 1|||Manual Length = 576 Score = 26.6 bits (56), Expect = 3.9 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = +2 Query: 374 PVVAQGSFSWTSPEGVPISVNYVADENGYQPTGNAIPTSPPVPEQIARALAYIAKNIP-- 547 P + +F+ S VP S + A G + + T+PP P++ A + KNIP Sbjct: 185 PFDSLNAFNEPSHSHVPNSASSTALSRGM--SNSVTLTAPPEPDEETIPTAIVIKNIPFS 242 Query: 548 LKK 556 LKK Sbjct: 243 LKK 245 >SPAC1A6.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 636 Score = 25.8 bits (54), Expect = 6.8 Identities = 19/64 (29%), Positives = 28/64 (43%) Frame = +2 Query: 203 PVRVVPKVSEGYGAETVKFGNEINPDGSYTYFYETNNGIAAQEQGVPRNLGGNPPAVPVV 382 P VP V+ GA + P+ +Y+ +N+ A E GG PP+VP + Sbjct: 540 PAPPVPSVNNA-GARLTLRDSGAAPEATYSLRQPSNH--AYSEGRSYTFTGGQPPSVPTM 596 Query: 383 AQGS 394 GS Sbjct: 597 PYGS 600 >SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1841 Score = 25.8 bits (54), Expect = 6.8 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = +2 Query: 362 PPAVPVVAQGSFSWTSPEGVPISVNYVADENGYQPTGNAIPTSPPVPEQIARA 520 PP P+ + S + S P SVN VA++ A P PP P + A Sbjct: 908 PPPPPLPVKTSLNTFSH---PDSVNIVANDTSVAGVMPAFPPPPPPPPPLVSA 957 >SPBPB2B2.11 |||nucleotide-sugar 4,6-dehydratase |Schizosaccharomyces pombe|chr 2|||Manual Length = 365 Score = 25.4 bits (53), Expect = 9.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 85 LGGNRCHHASEYYCEFHFCYSSKTSYV 5 +G N +A + Y +FHF K SYV Sbjct: 21 IGSNFLDYAVDKYPDFHFTCIDKLSYV 47 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,111,631 Number of Sequences: 5004 Number of extensions: 68628 Number of successful extensions: 223 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 171 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 199 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 367316502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -