BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30800 (765 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 31 0.039 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 26 1.5 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 25 1.9 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 25 2.6 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 25 2.6 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 24 5.9 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 31.1 bits (67), Expect = 0.039 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +2 Query: 380 VAQGSFSWTSPEGVPISVNYVAD-ENGYQPTGNAIPTSPPVPEQIARALAYIAKNI 544 V QGS+S P+G +V+Y AD NG+ NA+ P+ + A A +A + Sbjct: 48 VVQGSYSVVDPDGTKRTVDYTADPHNGF----NAVVRREPLAAKTIVAAAPVATKV 99 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 25.8 bits (54), Expect = 1.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 Query: 384 HRAHSPGHLLKVFPSASITSPTRT 455 HR PGH+ + P S +PT T Sbjct: 205 HRCRKPGHMKRDCPMESNNTPTST 228 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 25.4 bits (53), Expect = 1.9 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 256 FDSLSAVTLRYLGYYSDGGNRGDRDGQKRSR 164 + + S +L L Y DGG G D KR+R Sbjct: 900 YSNSSINSLNSLDNYGDGGEAGTGDSGKRAR 930 Score = 24.2 bits (50), Expect = 4.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -2 Query: 128 TGMGSSCRIHFHTGLGRQPLPP 63 TGM S R F G+G P PP Sbjct: 766 TGMPSPSRSAFADGIGSPPPPP 787 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 25.0 bits (52), Expect = 2.6 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +2 Query: 440 VADENGYQPTGNAIPTSPPVPEQIARALAYIAKNIPL 550 VADE Y+ G A PP E I AL + N+ L Sbjct: 315 VADEELYELGGQAGGKPPPAKETIHFALPELLHNLNL 351 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 25.0 bits (52), Expect = 2.6 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -1 Query: 417 PSGDVQENEPCATTGTAGGFPPRLRGTP 334 P GD Q + P + GG PP TP Sbjct: 324 PMGDPQTSRPPSGNDNMGGGPPPSSATP 351 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 23.8 bits (49), Expect = 5.9 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -2 Query: 413 QEMSRRMSPVQRREQQGGFHQGYVELP 333 Q+ ++ +QRR+QQ HQG +P Sbjct: 264 QQPQQKQQQLQRRQQQQQQHQGQRYVP 290 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 800,980 Number of Sequences: 2352 Number of extensions: 18876 Number of successful extensions: 72 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -