BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30794 (584 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39472-10|AAZ82853.1| 354|Caenorhabditis elegans Serpentine rec... 29 2.4 Z98877-16|CAH60800.1| 975|Caenorhabditis elegans Hypothetical p... 28 5.6 Z98877-15|CAB63407.3| 572|Caenorhabditis elegans Hypothetical p... 28 5.6 Z73976-2|CAA98285.1| 360|Caenorhabditis elegans Hypothetical pr... 27 7.4 U50135-4|AAA93455.3| 1487|Caenorhabditis elegans Hypothetical pr... 27 9.8 U00055-6|AAA50724.1| 494|Caenorhabditis elegans Hypothetical pr... 27 9.8 AF067214-3|AAC17002.1| 211|Caenorhabditis elegans Hypothetical ... 27 9.8 AC024765-5|AAF60527.3| 975|Caenorhabditis elegans Hypothetical ... 27 9.8 >U39472-10|AAZ82853.1| 354|Caenorhabditis elegans Serpentine receptor, class a (alpha)protein 36 protein. Length = 354 Score = 29.1 bits (62), Expect = 2.4 Identities = 18/73 (24%), Positives = 34/73 (46%) Frame = -1 Query: 344 TDFSLKT*LFIH*LLMMSEKL*NTKYAILFFCKPNKNIYTLGI*CFYERLFCNVVDIYLY 165 T +S + +F+H L+++ + K + K + T + FY + DIY Sbjct: 26 TSYSSRLNIFLHNLVIILTMVFTRKAVKIMLSKSMFSTTTRNL-LFYCMNYYIFHDIYFA 84 Query: 164 YLLPWSMYRECER 126 + + WS+YR E+ Sbjct: 85 FTMNWSLYRSIEK 97 >Z98877-16|CAH60800.1| 975|Caenorhabditis elegans Hypothetical protein Y69H2.10b protein. Length = 975 Score = 27.9 bits (59), Expect = 5.6 Identities = 10/31 (32%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -2 Query: 139 ESASECV-GCTCAREHRRDTPPTSAPHTRTC 50 ++ ++C+ GCTC ++RD+ H+R C Sbjct: 484 KAPAKCLPGCTCRPAYKRDSDSGQCVHSRQC 514 >Z98877-15|CAB63407.3| 572|Caenorhabditis elegans Hypothetical protein Y69H2.10a protein. Length = 572 Score = 27.9 bits (59), Expect = 5.6 Identities = 10/31 (32%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -2 Query: 139 ESASECV-GCTCAREHRRDTPPTSAPHTRTC 50 ++ ++C+ GCTC ++RD+ H+R C Sbjct: 484 KAPAKCLPGCTCRPAYKRDSDSGQCVHSRQC 514 >Z73976-2|CAA98285.1| 360|Caenorhabditis elegans Hypothetical protein T07C12.6 protein. Length = 360 Score = 27.5 bits (58), Expect = 7.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 262 IAYLVFYSFSLIINS*CIKSYV 327 I L+FY F+ INS C+K Y+ Sbjct: 34 ITELIFYFFAFYINSVCLKVYL 55 >U50135-4|AAA93455.3| 1487|Caenorhabditis elegans Hypothetical protein C52E12.4 protein. Length = 1487 Score = 27.1 bits (57), Expect = 9.8 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +3 Query: 9 DIALLDVKWRVRGVHVRVCGAEVGGVSRRCSRAHVHPTHSLALSIHT-PR 155 D+A+ D +++ HVR A G+ + R H HP +++ HT PR Sbjct: 128 DLAICDAMAQLQQDHVREITARHNGIIEKQQRIH-HPPGTVSGGTHTLPR 176 >U00055-6|AAA50724.1| 494|Caenorhabditis elegans Hypothetical protein R02F2.8 protein. Length = 494 Score = 27.1 bits (57), Expect = 9.8 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 364 CSGTFRNLRAPGRT*VGRC 420 C GTFRNL G+ +G C Sbjct: 471 CCGTFRNLTVSGQNPIGYC 489 >AF067214-3|AAC17002.1| 211|Caenorhabditis elegans Hypothetical protein F56C3.5 protein. Length = 211 Score = 27.1 bits (57), Expect = 9.8 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -3 Query: 411 HLGSTWRPKISKRSTTKHKNGLYRFFVENVTFY 313 H P+I KR + K+ NG++ F+ + FY Sbjct: 170 HCSENMGPEI-KRMSIKYNNGIFYLFINLIDFY 201 >AC024765-5|AAF60527.3| 975|Caenorhabditis elegans Hypothetical protein Y39A3CR.3 protein. Length = 975 Score = 27.1 bits (57), Expect = 9.8 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 176 YQQRYKIAFRKNIRSLKCIYFCLAYKK 256 + Y + NI KC+Y CL ++K Sbjct: 87 HSDNYTVKIEANILLAKCLYACLEFRK 113 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,100,252 Number of Sequences: 27780 Number of extensions: 230998 Number of successful extensions: 782 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 782 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1226509528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -