BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30790 (560 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1657 - 35102751-35102868,35102987-35103504,35104065-351042... 28 5.9 >04_04_1657 - 35102751-35102868,35102987-35103504,35104065-35104211, 35104289-35106262,35106964-35107089,35107178-35107264, 35107335-35107424,35107725-35107811,35108248-35108300, 35109339-35109387 Length = 1082 Score = 27.9 bits (59), Expect = 5.9 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +1 Query: 304 FCFTGKYRHQDVTSSRMNRVTVHTKYALSY*FSMNASRPYKTCDVC 441 F FT K RH ++ + +K AL S N +PY+ CD C Sbjct: 646 FGFTRK-RHNCYNCGLVHCHSCSSKKALRAALSPNPGKPYRVCDSC 690 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,855,732 Number of Sequences: 37544 Number of extensions: 229181 Number of successful extensions: 368 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 368 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1281410928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -