BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30787 (516 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U04809-1|AAA19430.1| 622|Drosophila melanogaster cocaine-sensit... 29 3.7 AY071023-1|AAL48645.1| 622|Drosophila melanogaster RE10485p pro... 29 3.7 AY061451-1|AAL28999.1| 249|Drosophila melanogaster LD38807p pro... 29 3.7 AE013599-3863|AAF47200.1| 622|Drosophila melanogaster CG4545-PA... 29 3.7 AE014297-2568|AAF55584.1| 950|Drosophila melanogaster CG7709-PA... 28 6.5 >U04809-1|AAA19430.1| 622|Drosophila melanogaster cocaine-sensitive serotonin transporterprotein. Length = 622 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -1 Query: 345 HRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRET 241 H PA + D PL P +NE + VV R+RET Sbjct: 44 HTTPAKVTD--PLAPKLANNERILVVSVTERTRET 76 >AY071023-1|AAL48645.1| 622|Drosophila melanogaster RE10485p protein. Length = 622 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -1 Query: 345 HRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRET 241 H PA + D PL P +NE + VV R+RET Sbjct: 44 HTTPAKVTD--PLAPKLANNERILVVSVTERTRET 76 >AY061451-1|AAL28999.1| 249|Drosophila melanogaster LD38807p protein. Length = 249 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = -1 Query: 252 SRETISHLCYTSHVSL---QCQTRVKLNRVFFPR*FSQARSLGC 130 S+ TI CY ++S QCQ R+ +VFF S A C Sbjct: 14 SKRTIFETCYMKNISFLKTQCQARILFCKVFFAVHSSNANVPSC 57 >AE013599-3863|AAF47200.1| 622|Drosophila melanogaster CG4545-PA protein. Length = 622 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -1 Query: 345 HRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRET 241 H PA + D PL P +NE + VV R+RET Sbjct: 44 HTTPAKVTD--PLAPKLANNERILVVSVTERTRET 76 >AE014297-2568|AAF55584.1| 950|Drosophila melanogaster CG7709-PA protein. Length = 950 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = -2 Query: 239 SPTYATPLMSPYNARLESSSTGSSFPADSPKP 144 +P++ + S Y A +S+S+G +PA +P+P Sbjct: 153 APSFNSAPSSSYAAPSQSASSGGPYPAAAPRP 184 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,565,830 Number of Sequences: 53049 Number of extensions: 531217 Number of successful extensions: 1791 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1791 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1887744768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -