BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30785 (739 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 23 3.0 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 22 6.9 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 23.0 bits (47), Expect = 3.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 640 NFSIVMSMQMSHQCNKVNKLDSNF 711 N ++ +M+H N VNKL ++F Sbjct: 486 NLMAQVNTEMTHLTNAVNKLKTSF 509 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.8 bits (44), Expect = 6.9 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 248 YINFTKALNG*IDLYMLSVKKSNFRSPLT*NLKKCCIVFF 367 Y+ FT L + ++V NFRSP+T + + V F Sbjct: 302 YLLFTMVLVTLSVVVTIAVLNVNFRSPVTHRMARWVRVVF 341 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,926 Number of Sequences: 438 Number of extensions: 3839 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -