BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30784 (652 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY095191-1|AAM12284.1| 597|Drosophila melanogaster LD36009p pro... 28 9.6 AY069289-1|AAL39434.1| 1137|Drosophila melanogaster GM14421p pro... 28 9.6 AE014298-2419|AAF48620.1| 1137|Drosophila melanogaster CG9902-PA... 28 9.6 AE014134-2606|AAF53465.1| 597|Drosophila melanogaster CG4162-PA... 28 9.6 AB017359-1|BAA83721.1| 597|Drosophila melanogaster serine palmi... 28 9.6 >AY095191-1|AAM12284.1| 597|Drosophila melanogaster LD36009p protein. Length = 597 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 378 YDRPRCSVP*DEYTAHLKSNYHRPWASAMPGAEPSRCL 491 ++RP CSVP DE T + W+ G E +RCL Sbjct: 180 WNRPICSVPGDELTLKDRVTDDYGWSFKFTGTE-TRCL 216 >AY069289-1|AAL39434.1| 1137|Drosophila melanogaster GM14421p protein. Length = 1137 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 416 YGAPEE*LPSPVGISNARGRAKPLPTVLDKFYK 514 YG EE + +SNA G+A+ P V DK K Sbjct: 675 YGTIEEGYENETNLSNAAGKAESTPAVHDKAEK 707 >AE014298-2419|AAF48620.1| 1137|Drosophila melanogaster CG9902-PA protein. Length = 1137 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 416 YGAPEE*LPSPVGISNARGRAKPLPTVLDKFYK 514 YG EE + +SNA G+A+ P V DK K Sbjct: 675 YGTIEEGYENETNLSNAAGKAESTPAVHDKAEK 707 >AE014134-2606|AAF53465.1| 597|Drosophila melanogaster CG4162-PA protein. Length = 597 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 378 YDRPRCSVP*DEYTAHLKSNYHRPWASAMPGAEPSRCL 491 ++RP CSVP DE T + W+ G E +RCL Sbjct: 180 WNRPICSVPGDELTLKDRVTDDYGWSFKFTGTE-TRCL 216 >AB017359-1|BAA83721.1| 597|Drosophila melanogaster serine palmitoyl transferase LCB2subunit protein. Length = 597 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 378 YDRPRCSVP*DEYTAHLKSNYHRPWASAMPGAEPSRCL 491 ++RP CSVP DE T + W+ G E +RCL Sbjct: 180 WNRPICSVPGDELTLKDRVTDDYGWSFKFTGTE-TRCL 216 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,088,800 Number of Sequences: 53049 Number of extensions: 482783 Number of successful extensions: 873 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 859 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 873 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2765538900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -