BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30780 (720 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 76 3e-14 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 71 1e-12 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 66 3e-11 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 65 6e-11 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 8e-10 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 8e-10 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 8e-10 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) 53 3e-07 SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 52 6e-07 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 50 1e-06 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 50 1e-06 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 50 1e-06 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 50 1e-06 SB_55341| Best HMM Match : Mt_ATP-synt_B (HMM E-Value=0.0013) 50 2e-06 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 49 4e-06 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_55650| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 48 1e-05 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 48 1e-05 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 47 1e-05 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 47 1e-05 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 47 1e-05 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 47 1e-05 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 47 1e-05 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 47 1e-05 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 47 1e-05 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 47 1e-05 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 47 1e-05 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 47 1e-05 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 47 1e-05 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 47 1e-05 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 47 1e-05 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 47 1e-05 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 47 1e-05 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 47 1e-05 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 47 1e-05 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 47 1e-05 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 47 1e-05 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 47 1e-05 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 47 1e-05 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 47 1e-05 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 47 1e-05 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 47 1e-05 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 47 1e-05 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 47 1e-05 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 47 1e-05 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 47 1e-05 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 47 1e-05 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 47 1e-05 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 47 1e-05 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 47 1e-05 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 47 1e-05 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 47 1e-05 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 47 1e-05 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 47 1e-05 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 47 1e-05 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 47 1e-05 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 47 1e-05 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 47 1e-05 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 47 1e-05 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 47 1e-05 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 47 1e-05 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 47 1e-05 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 47 1e-05 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 47 1e-05 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 47 1e-05 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 47 1e-05 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 47 1e-05 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 47 1e-05 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 47 1e-05 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 47 1e-05 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 47 1e-05 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 47 1e-05 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 47 1e-05 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 47 1e-05 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 47 1e-05 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 47 1e-05 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 47 1e-05 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 47 1e-05 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 47 1e-05 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 47 1e-05 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 47 1e-05 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 47 1e-05 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 47 1e-05 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 47 1e-05 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 47 1e-05 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 47 1e-05 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 47 1e-05 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 47 1e-05 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 79.8 bits (188), Expect = 2e-15 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = +1 Query: 607 IRPIVSRITIHWPSFYNVRDWENPGVTQLNRLAAHSPF 720 IRPIVSRITIHWPSFY RDWENPGV QLNRLAAH PF Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPF 55 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -1 Query: 714 GMCCKAIKLGNARVFPVTNVVKGRPVNCNTTHYRANW 604 GMCCKAIKLGNA VFP +VVK RPVNCNTTHYRANW Sbjct: 17 GMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -1 Query: 714 GMCCKAIKLGNARVFPVTNVVKGRPVNCNTTHYRANW 604 GMCCKAIKLGNA VFP +VVK RPVNCNTTHYRANW Sbjct: 31 GMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 74.5 bits (175), Expect = 8e-14 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -1 Query: 714 GMCCKAIKLGNARVFPVTNVVKGRPVNCNTTHYRANW 604 GMCCKAIKLGNA+ FP +VVK RPVNCNTTHYRANW Sbjct: 23 GMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 71.3 bits (167), Expect = 7e-13 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +1 Query: 622 SRITIHWPSFYNVRDWENPGVTQLNRLAAHSPF 720 SRITIHWPSFYNV WENPGVTQLNRLAAH PF Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPF 34 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 70.5 bits (165), Expect = 1e-12 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -1 Query: 714 GMCCKAIKLGNARVFPVTNVVKGRPVNCNTTHYRANW 604 GMCCK+IKL +A VFP +VVK RPVNCNTTHYRANW Sbjct: 25 GMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -1 Query: 714 GMCCKAIKLGNARVFPVTNVVKGRPVNCNTTHYRAN 607 GMCCKAIKLGNA VF +VVK RPVNCNTTHYRAN Sbjct: 5 GMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 66.5 bits (155), Expect = 2e-11 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +1 Query: 619 VSRITIHWPSFYNVRDWENPGVTQLNRLAAHSPF 720 +SRITIHWPS RDWENPGVTQLNRLAAH PF Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPF 310 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 66.1 bits (154), Expect = 3e-11 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -1 Query: 714 GMCCKAIKLGNARVFPVTNVVKGRPVNCNTTHYRAN 607 GMCCKAIKLGNAR FP + K RPVNCNTTHYRAN Sbjct: 62 GMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 64.9 bits (151), Expect = 6e-11 Identities = 31/44 (70%), Positives = 33/44 (75%) Frame = +1 Query: 589 GGARYPIRPIVSRITIHWPSFYNVRDWENPGVTQLNRLAAHSPF 720 GGA PIRPIVSRITIHWP+FYN + TQLNRLAAH PF Sbjct: 36 GGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPF 77 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 64.5 bits (150), Expect = 8e-11 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 622 SRITIHWPSFYNVRDWENPGVTQLNRLAAHSPF 720 SRITIHWPSFYNV +NPGVTQLNRLAAH PF Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPF 34 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 64.1 bits (149), Expect = 1e-10 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -1 Query: 714 GMCCKAIKLGNARVFPVTNVVKGRPVNCNTTHYRANW 604 GMCCKAIKL VFP +VVK RPVNCNTTHYRANW Sbjct: 1864 GMCCKAIKLVTP-VFPSHDVVKRRPVNCNTTHYRANW 1899 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 61.3 bits (142), Expect = 8e-10 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +1 Query: 622 SRITIHWPSFYNVRDWENPGVTQLNRLAAHSPF 720 SRITIHWPSFYNV +N GVTQLNRLAAH PF Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPF 34 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 61.3 bits (142), Expect = 8e-10 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +1 Query: 622 SRITIHWPSFYNVRDWENPGVTQLNRLAAHSPF 720 SRITIHWPSFYNV + PGVTQLNRLAAH PF Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPF 34 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 61.3 bits (142), Expect = 8e-10 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +1 Query: 622 SRITIHWPSFYNVRDWENPGVTQLNRLAAHSPF 720 SRITIHWPSFYNV +N GVTQLNRLAAH PF Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPF 34 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 55.6 bits (128), Expect = 4e-08 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 622 SRITIHWPSFYNVRDWENPGVTQLNRLAAHSPF 720 SRITIHWPSFYNV + VTQLNRLAAH PF Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPF 34 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 54.8 bits (126), Expect = 7e-08 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = -1 Query: 720 KGGMCCKAIKLGNARVFPVTNVVKGRPVNCNTTHYRANW 604 KG + +KLG + FP +VVK RPVNCNTTHYRANW Sbjct: 64 KGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) Length = 282 Score = 52.8 bits (121), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +1 Query: 640 WPSFYNVRDWENPGVTQLNRLAAHSPF 720 WPS YN RDW N GVTQLNRL AH PF Sbjct: 218 WPSIYNDRDWNNSGVTQLNRLVAHLPF 244 >SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +2 Query: 635 FTGRPFTTFVTGKTLALPNLIALQHIP 715 +TGR FTT VTGKTLALPNLIALQHIP Sbjct: 54 WTGRRFTTLVTGKTLALPNLIALQHIP 80 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 51.6 bits (118), Expect = 6e-07 Identities = 29/50 (58%), Positives = 30/50 (60%), Gaps = 7/50 (14%) Frame = +1 Query: 592 GARYPIRPIVSRITIHWPSFYNV-------RDWENPGVTQLNRLAAHSPF 720 G YP P SR H S+YN RDWENPGVTQLNRLAAH PF Sbjct: 42 GLNYPFVPKSSR---HSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 88 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 50.4 bits (115), Expect = 1e-06 Identities = 24/36 (66%), Positives = 26/36 (72%), Gaps = 7/36 (19%) Frame = +1 Query: 634 IHWPSFYNV-------RDWENPGVTQLNRLAAHSPF 720 IH+ S+YN RDWENPGVTQLNRLAAH PF Sbjct: 1464 IHYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 1499 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 50.4 bits (115), Expect = 1e-06 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = -1 Query: 720 KGGMCCKAIKLGNARVFPVTNVVKGRPVNCNTTHYRANW 604 KGG + + G FP +VVK RPVNCNTTHYRANW Sbjct: 614 KGGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRANW 648 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = -1 Query: 684 NARVFPVTNVVKGRPVNCNTTHYRANW 604 +A VFP +VVK RPVNCNTTHYRANW Sbjct: 33 HAIVFPSHDVVKRRPVNCNTTHYRANW 59 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 50.4 bits (115), Expect = 1e-06 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = -1 Query: 720 KGGMCCKAIKLGNARVFPVTNVVKGRPVNCNTTHYRANW 604 KGG + + G FP +VVK RPVNCNTTHYRANW Sbjct: 57 KGGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 50.4 bits (115), Expect = 1e-06 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = -1 Query: 720 KGGMCCKAIKLGNARVFPVTNVVKGRPVNCNTTHYRANW 604 KGG + + G FP +VVK RPVNCNTTHYRANW Sbjct: 57 KGGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRANW 91 >SB_55341| Best HMM Match : Mt_ATP-synt_B (HMM E-Value=0.0013) Length = 185 Score = 50.0 bits (114), Expect = 2e-06 Identities = 29/80 (36%), Positives = 40/80 (50%) Frame = +1 Query: 1 GPYTFGVGLATYLCSKEIYVMEHEYYSGLSLLVMVYVAHVKFGPKLAAWLDKEVEATENE 180 G F GLA YL S EI ++ E Y + Y K G +A LD + + Sbjct: 72 GQLMFFGGLAAYLLSNEILIIHEETYIAAVMGGTFYWLMKKAGGPIAEMLDNTSQEILDA 131 Query: 181 WNEGRNQTVKALEDAIEGEK 240 +N GRN ++K L+DAI+ EK Sbjct: 132 FNVGRNASIKHLQDAIDNEK 151 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 49.6 bits (113), Expect = 3e-06 Identities = 23/45 (51%), Positives = 26/45 (57%) Frame = +1 Query: 586 RGGARYPIRPIVSRITIHWPSFYNVRDWENPGVTQLNRLAAHSPF 720 RGG P+ ++ RDWENPGVTQLNRLAAH PF Sbjct: 43 RGGIGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 87 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +1 Query: 637 HWPSFYNVRDWENPGVTQLNRLAAHSPF 720 HWPSFYNV + GVTQLNRLAAH PF Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPF 32 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/39 (58%), Positives = 28/39 (71%), Gaps = 3/39 (7%) Frame = +1 Query: 613 PIVSRITIHWPSFYNV---RDWENPGVTQLNRLAAHSPF 720 P++ R+ ++ S V RDWENPGVTQLNRLAAH PF Sbjct: 50 PVMGRLESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 88 >SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/44 (54%), Positives = 31/44 (70%) Frame = -1 Query: 711 MCCKAIKLGNARVFPVTNVVKGRPVNCNTTHYRANWVPGPPSRL 580 MCCKAIKLGNARVFP +VVK RPV + H + + PP+++ Sbjct: 1 MCCKAIKLGNARVFPSHDVVKRRPV--PSLHACRSTLEDPPNKI 42 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/46 (47%), Positives = 27/46 (58%) Frame = +1 Query: 583 SRGGARYPIRPIVSRITIHWPSFYNVRDWENPGVTQLNRLAAHSPF 720 ++GG P+ ++ RDWENPGVTQLNRLAAH PF Sbjct: 50 AQGGVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 95 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 48.4 bits (110), Expect = 6e-06 Identities = 25/40 (62%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = -1 Query: 720 KGGMCCKAIKLGNARV-FPVTNVVKGRPVNCNTTHYRANW 604 KGG C A +L FP +VVK RPVNCNTTHYRANW Sbjct: 43 KGG--CAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 48.0 bits (109), Expect = 8e-06 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 672 FPVTNVVKGRPVNCNTTHYRANW 604 FP +VVK RPVNCNTTHYRANW Sbjct: 2 FPSHDVVKRRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 48.0 bits (109), Expect = 8e-06 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 672 FPVTNVVKGRPVNCNTTHYRANW 604 FP +VVK RPVNCNTTHYRANW Sbjct: 58 FPSHDVVKRRPVNCNTTHYRANW 80 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.0 bits (109), Expect = 8e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +1 Query: 649 FYNVRDWENPGVTQLNRLAAHSPF 720 F RDWENPGVTQLNRLAAH PF Sbjct: 68 FLQRRDWENPGVTQLNRLAAHPPF 91 >SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.0 bits (109), Expect = 8e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +1 Query: 649 FYNVRDWENPGVTQLNRLAAHSPF 720 F RDWENPGVTQLNRLAAH PF Sbjct: 11 FLQRRDWENPGVTQLNRLAAHPPF 34 >SB_55650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/59 (47%), Positives = 31/59 (52%), Gaps = 14/59 (23%) Frame = +1 Query: 586 RGGARYPIRPIVSRITIHWPS-------FYNV-------RDWENPGVTQLNRLAAHSPF 720 + G R PI + R W S +YN RDWENPGVTQLNRLAAH PF Sbjct: 46 KNGQRAPINDFLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 104 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 47.6 bits (108), Expect = 1e-05 Identities = 25/55 (45%), Positives = 31/55 (56%) Frame = +1 Query: 556 KCN*NREN*SRGGARYPIRPIVSRITIHWPSFYNVRDWENPGVTQLNRLAAHSPF 720 +C+ N N S+ G P+ ++ RDWENPGVTQLNRLAAH PF Sbjct: 280 ECHYNPRNTSQVGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 332 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = +1 Query: 589 GGARYPIRPIVSRITIHWPSFYNVRDWENPGVTQLNRLAAHSPF 720 G +YP ++ RDWENPGVTQLNRLAAH PF Sbjct: 17 GYIKYPPESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 60 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 42 RDWENPGVTQLNRLAAHPPF 61 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 22 RDWENPGVTQLNRLAAHPPF 41 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 69 RDWENPGVTQLNRLAAHPPF 88 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 51 RDWENPGVTQLNRLAAHPPF 70 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 43 RDWENPGVTQLNRLAAHPPF 62 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 69 RDWENPGVTQLNRLAAHPPF 88 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 74 RDWENPGVTQLNRLAAHPPF 93 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 45 RDWENPGVTQLNRLAAHPPF 64 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 65 RDWENPGVTQLNRLAAHPPF 84 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 77 RDWENPGVTQLNRLAAHPPF 96 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 53 RDWENPGVTQLNRLAAHPPF 72 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 42 RDWENPGVTQLNRLAAHPPF 61 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 32 RDWENPGVTQLNRLAAHPPF 51 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 57 RDWENPGVTQLNRLAAHPPF 76 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 66 RDWENPGVTQLNRLAAHPPF 85 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 60 RDWENPGVTQLNRLAAHPPF 79 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 76 RDWENPGVTQLNRLAAHPPF 95 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 64 RDWENPGVTQLNRLAAHPPF 83 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 47 RDWENPGVTQLNRLAAHPPF 66 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 47 RDWENPGVTQLNRLAAHPPF 66 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 223 RDWENPGVTQLNRLAAHPPF 242 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 118 RDWENPGVTQLNRLAAHPPF 137 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 56 RDWENPGVTQLNRLAAHPPF 75 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 35 RDWENPGVTQLNRLAAHPPF 54 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 23 RDWENPGVTQLNRLAAHPPF 42 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 54 RDWENPGVTQLNRLAAHPPF 73 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 388 RDWENPGVTQLNRLAAHPPF 407 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 114 RDWENPGVTQLNRLAAHPPF 133 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 90 RDWENPGVTQLNRLAAHPPF 109 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 46 RDWENPGVTQLNRLAAHPPF 65 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 15 RDWENPGVTQLNRLAAHPPF 34 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 25 RDWENPGVTQLNRLAAHPPF 44 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 45 RDWENPGVTQLNRLAAHPPF 64 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 110 RDWENPGVTQLNRLAAHPPF 129 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 52 RDWENPGVTQLNRLAAHPPF 71 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 347 RDWENPGVTQLNRLAAHPPF 366 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 87 RDWENPGVTQLNRLAAHPPF 106 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 57 RDWENPGVTQLNRLAAHPPF 76 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 23 RDWENPGVTQLNRLAAHPPF 42 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 66 RDWENPGVTQLNRLAAHPPF 85 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 50 RDWENPGVTQLNRLAAHPPF 69 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 141 RDWENPGVTQLNRLAAHPPF 160 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 70 RDWENPGVTQLNRLAAHPPF 89 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 46 RDWENPGVTQLNRLAAHPPF 65 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 150 RDWENPGVTQLNRLAAHPPF 169 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 840 RDWENPGVTQLNRLAAHPPF 859 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 23 RDWENPGVTQLNRLAAHPPF 42 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 67 RDWENPGVTQLNRLAAHPPF 86 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 41 RDWENPGVTQLNRLAAHPPF 60 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 80 RDWENPGVTQLNRLAAHPPF 99 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 74 RDWENPGVTQLNRLAAHPPF 93 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 63 RDWENPGVTQLNRLAAHPPF 82 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 76 RDWENPGVTQLNRLAAHPPF 95 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 263 RDWENPGVTQLNRLAAHPPF 282 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 121 RDWENPGVTQLNRLAAHPPF 140 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 57 RDWENPGVTQLNRLAAHPPF 76 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 43 RDWENPGVTQLNRLAAHPPF 62 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 44 RDWENPGVTQLNRLAAHPPF 63 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 108 RDWENPGVTQLNRLAAHPPF 127 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 121 RDWENPGVTQLNRLAAHPPF 140 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 46 RDWENPGVTQLNRLAAHPPF 65 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 27 RDWENPGVTQLNRLAAHPPF 46 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 65 RDWENPGVTQLNRLAAHPPF 84 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 44 RDWENPGVTQLNRLAAHPPF 63 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 41 RDWENPGVTQLNRLAAHPPF 60 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 18 RDWENPGVTQLNRLAAHPPF 37 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 26 RDWENPGVTQLNRLAAHPPF 45 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 403 RDWENPGVTQLNRLAAHPPF 422 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 52 RDWENPGVTQLNRLAAHPPF 71 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 61 RDWENPGVTQLNRLAAHPPF 80 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 43 RDWENPGVTQLNRLAAHPPF 62 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 126 RDWENPGVTQLNRLAAHPPF 145 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 62 RDWENPGVTQLNRLAAHPPF 81 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 72 RDWENPGVTQLNRLAAHPPF 91 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 75 RDWENPGVTQLNRLAAHPPF 94 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 421 RDWENPGVTQLNRLAAHPPF 440 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 118 RDWENPGVTQLNRLAAHPPF 137 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 74 RDWENPGVTQLNRLAAHPPF 93 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 63 RDWENPGVTQLNRLAAHPPF 82 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 53 RDWENPGVTQLNRLAAHPPF 72 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 56 RDWENPGVTQLNRLAAHPPF 75 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 168 RDWENPGVTQLNRLAAHPPF 187 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 72 RDWENPGVTQLNRLAAHPPF 91 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 59 RDWENPGVTQLNRLAAHPPF 78 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 95 RDWENPGVTQLNRLAAHPPF 114 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 44 RDWENPGVTQLNRLAAHPPF 63 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 70 RDWENPGVTQLNRLAAHPPF 89 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 49 RDWENPGVTQLNRLAAHPPF 68 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 192 RDWENPGVTQLNRLAAHPPF 211 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 41 RDWENPGVTQLNRLAAHPPF 60 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 47 RDWENPGVTQLNRLAAHPPF 66 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 61 RDWENPGVTQLNRLAAHPPF 80 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 58 RDWENPGVTQLNRLAAHPPF 77 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 41 RDWENPGVTQLNRLAAHPPF 60 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 42 RDWENPGVTQLNRLAAHPPF 61 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 56 RDWENPGVTQLNRLAAHPPF 75 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 46 RDWENPGVTQLNRLAAHPPF 65 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 139 RDWENPGVTQLNRLAAHPPF 158 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 48 RDWENPGVTQLNRLAAHPPF 67 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 91 RDWENPGVTQLNRLAAHPPF 110 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 29 RDWENPGVTQLNRLAAHPPF 48 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 160 RDWENPGVTQLNRLAAHPPF 179 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 347 RDWENPGVTQLNRLAAHPPF 366 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 64 RDWENPGVTQLNRLAAHPPF 83 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 28 RDWENPGVTQLNRLAAHPPF 47 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 54 RDWENPGVTQLNRLAAHPPF 73 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 116 RDWENPGVTQLNRLAAHPPF 135 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 93 RDWENPGVTQLNRLAAHPPF 112 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 43 RDWENPGVTQLNRLAAHPPF 62 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 67 RDWENPGVTQLNRLAAHPPF 86 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 301 RDWENPGVTQLNRLAAHPPF 320 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 64 RDWENPGVTQLNRLAAHPPF 83 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 65 RDWENPGVTQLNRLAAHPPF 84 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 23 RDWENPGVTQLNRLAAHPPF 42 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 43 RDWENPGVTQLNRLAAHPPF 62 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 418 RDWENPGVTQLNRLAAHPPF 437 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 102 RDWENPGVTQLNRLAAHPPF 121 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 58 RDWENPGVTQLNRLAAHPPF 77 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 50 RDWENPGVTQLNRLAAHPPF 69 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 100 RDWENPGVTQLNRLAAHPPF 119 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 50 RDWENPGVTQLNRLAAHPPF 69 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 218 RDWENPGVTQLNRLAAHPPF 237 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 50 RDWENPGVTQLNRLAAHPPF 69 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 220 RDWENPGVTQLNRLAAHPPF 239 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 40 RDWENPGVTQLNRLAAHPPF 59 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 55 RDWENPGVTQLNRLAAHPPF 74 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 45 RDWENPGVTQLNRLAAHPPF 64 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 50 RDWENPGVTQLNRLAAHPPF 69 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 154 RDWENPGVTQLNRLAAHPPF 173 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 52 RDWENPGVTQLNRLAAHPPF 71 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 42 RDWENPGVTQLNRLAAHPPF 61 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 62 RDWENPGVTQLNRLAAHPPF 81 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 47 RDWENPGVTQLNRLAAHPPF 66 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 82 RDWENPGVTQLNRLAAHPPF 101 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 202 RDWENPGVTQLNRLAAHPPF 221 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 60 RDWENPGVTQLNRLAAHPPF 79 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 39 RDWENPGVTQLNRLAAHPPF 58 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 93 RDWENPGVTQLNRLAAHPPF 112 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 29 RDWENPGVTQLNRLAAHPPF 48 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 56 RDWENPGVTQLNRLAAHPPF 75 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 194 RDWENPGVTQLNRLAAHPPF 213 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 64 RDWENPGVTQLNRLAAHPPF 83 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 74 RDWENPGVTQLNRLAAHPPF 93 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 57 RDWENPGVTQLNRLAAHPPF 76 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 64 RDWENPGVTQLNRLAAHPPF 83 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 107 RDWENPGVTQLNRLAAHPPF 126 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 83 RDWENPGVTQLNRLAAHPPF 102 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 103 RDWENPGVTQLNRLAAHPPF 122 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 80 RDWENPGVTQLNRLAAHPPF 99 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 47 RDWENPGVTQLNRLAAHPPF 66 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 56 RDWENPGVTQLNRLAAHPPF 75 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 670 RDWENPGVTQLNRLAAHPPF 689 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 55 RDWENPGVTQLNRLAAHPPF 74 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 44 RDWENPGVTQLNRLAAHPPF 63 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 35 RDWENPGVTQLNRLAAHPPF 54 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 153 RDWENPGVTQLNRLAAHPPF 172 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 45 RDWENPGVTQLNRLAAHPPF 64 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 66 RDWENPGVTQLNRLAAHPPF 85 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 95 RDWENPGVTQLNRLAAHPPF 114 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 43 RDWENPGVTQLNRLAAHPPF 62 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 107 RDWENPGVTQLNRLAAHPPF 126 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 50 RDWENPGVTQLNRLAAHPPF 69 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 1197 RDWENPGVTQLNRLAAHPPF 1216 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 49 RDWENPGVTQLNRLAAHPPF 68 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 39 RDWENPGVTQLNRLAAHPPF 58 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 132 RDWENPGVTQLNRLAAHPPF 151 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 63 RDWENPGVTQLNRLAAHPPF 82 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 84 RDWENPGVTQLNRLAAHPPF 103 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 57 RDWENPGVTQLNRLAAHPPF 76 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 133 RDWENPGVTQLNRLAAHPPF 152 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 175 RDWENPGVTQLNRLAAHPPF 194 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 38 RDWENPGVTQLNRLAAHPPF 57 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 87 RDWENPGVTQLNRLAAHPPF 106 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 37 RDWENPGVTQLNRLAAHPPF 56 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 52 RDWENPGVTQLNRLAAHPPF 71 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 23 RDWENPGVTQLNRLAAHPPF 42 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 82 RDWENPGVTQLNRLAAHPPF 101 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 36 RDWENPGVTQLNRLAAHPPF 55 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 661 RDWENPGVTQLNRLAAHSPF 720 RDWENPGVTQLNRLAAH PF Sbjct: 932 RDWENPGVTQLNRLAAHPPF 951 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,450,866 Number of Sequences: 59808 Number of extensions: 452935 Number of successful extensions: 5219 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5177 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -