BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30779 (757 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 25 0.86 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 25 0.86 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 25 0.86 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 6.1 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 24.6 bits (51), Expect = 0.86 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +1 Query: 418 KHKADIHEDWTRGKE--EMLQSQDFRQCKLNDIKALKKKHEAFESDLAAHQDRVEQNRGH 591 K++ + + T KE E +++ ++ KLND L+K+ E +ES +RG Sbjct: 46 KYQKAVEKLLTEQKELAEKEEAETLKRYKLND---LEKRREVYESIFKVEVHEALMSRGE 102 Query: 592 R 594 R Sbjct: 103 R 103 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 24.6 bits (51), Expect = 0.86 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +1 Query: 418 KHKADIHEDWTRGKE--EMLQSQDFRQCKLNDIKALKKKHEAFESDLAAHQDRVEQNRGH 591 K++ + + T KE E +++ ++ KLND L+K+ E +ES +RG Sbjct: 206 KYQKAVEKLLTEQKELAEKEEAETLKRYKLND---LEKRREVYESIFKVEVHEALMSRGE 262 Query: 592 R 594 R Sbjct: 263 R 263 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 24.6 bits (51), Expect = 0.86 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +1 Query: 418 KHKADIHEDWTRGKE--EMLQSQDFRQCKLNDIKALKKKHEAFESDLAAHQDRVEQNRGH 591 K++ + + T KE E +++ ++ KLND L+K+ E +ES +RG Sbjct: 206 KYQKAVEKLLTEQKELAEKEEAETLKRYKLND---LEKRREVYESIFKVEVHEALMSRGE 262 Query: 592 R 594 R Sbjct: 263 R 263 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 Query: 118 RQTDNSLAGCQKKLED 165 R+TDNSL+ KK +D Sbjct: 70 RKTDNSLSATSKKDKD 85 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,046 Number of Sequences: 336 Number of extensions: 3257 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -