BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30778 (349 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 20 8.3 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 20 8.3 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 19.8 bits (39), Expect = 8.3 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 314 LLDDAPPFSSSTFXXXXXLIDGFLTQQQPE 225 +++ P F ST I + QQQP+ Sbjct: 28 VIETDPDFHESTMFNGGGEIPQNIIQQQPQ 57 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 19.8 bits (39), Expect = 8.3 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -2 Query: 108 SSPPXDAFFHHPPLLLCW 55 S P AFFH L L W Sbjct: 49 SLPTNPAFFHPGLLPLAW 66 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 55,445 Number of Sequences: 336 Number of extensions: 755 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6876025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -