BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30774 (816 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 23 2.2 DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase rever... 22 5.1 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 22 5.1 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 22 6.7 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 21 8.9 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 8.9 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +1 Query: 151 PGPTESYLRHHPNPAMRAPP 210 P T Y R+HP P PP Sbjct: 167 PVYTHHYARYHPYPNFGVPP 186 >DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase reverse transcriptase protein. Length = 73 Score = 22.2 bits (45), Expect = 5.1 Identities = 6/17 (35%), Positives = 15/17 (88%) Frame = +1 Query: 280 EEAPKVLHKQFNSPINL 330 ++APK+++ ++NS +N+ Sbjct: 13 QKAPKIVNSKYNSILNI 29 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 22.2 bits (45), Expect = 5.1 Identities = 6/17 (35%), Positives = 15/17 (88%) Frame = +1 Query: 280 EEAPKVLHKQFNSPINL 330 ++APK+++ ++NS +N+ Sbjct: 13 QKAPKIVNSKYNSILNI 29 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.8 bits (44), Expect = 6.7 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +1 Query: 7 PTSVTMSLNPNFFPNGYQDPKHPEEEVVSNWPY 105 PTSV L P+ P P P +++ PY Sbjct: 315 PTSVMTELYPSPVPGHSTSPNLPLTHNIAHNPY 347 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +3 Query: 243 KGGRVGAAASG 275 KGG GAAASG Sbjct: 119 KGGGAGAAASG 129 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +1 Query: 46 PNGYQDPKHPEEEVVSNWP 102 PN P PEEE S P Sbjct: 39 PNSAASPAPPEEEAASPTP 57 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,467 Number of Sequences: 336 Number of extensions: 4171 Number of successful extensions: 17 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22310335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -