BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30774 (816 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44200.1 68416.m04739 protein kinase family protein contains ... 31 1.2 At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly id... 31 1.2 At3g24860.1 68416.m03118 hydroxyproline-rich glycoprotein family... 29 2.8 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 29 4.9 At3g03950.2 68416.m00414 expressed protein contains Pfam profile... 28 6.4 At3g03950.1 68416.m00413 expressed protein contains Pfam profile... 28 6.4 At2g28830.1 68415.m03505 armadillo/beta-catenin repeat family pr... 28 6.4 >At3g44200.1 68416.m04739 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 941 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = +1 Query: 286 APKVLHKQFNSPINLYSEQNIANSIRQQTSPLPTNGHYGRPHVVKRQVFY*KRHNA 453 AP LH + + +N +S+ S+ Q S L N + PH V V + RH++ Sbjct: 702 APLPLHVEPSHQVNSHSDNK--TSVMSQNSALEKNNSHSHPHPVVDDVIHVIRHSS 755 >At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly identical to auxin transport protein; BIG [Arabidopsis thaliana] GI:21779966; contains Pfam profiles PF02207: Putative zinc finger in N-recognin, PF00569: Zinc finger ZZ type Length = 5098 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/45 (33%), Positives = 28/45 (62%) Frame = +2 Query: 416 SRGKSFTRNATMQQSTHILIDALMLLSIYYAIFRFLQTIYLFHAK 550 S+ ++ ++A+M++ ++ D L LLSIYY++ R Q + L K Sbjct: 2332 SKKRALAQSASMEEQ--VIADGLKLLSIYYSVCRPRQEVVLSELK 2374 >At3g24860.1 68416.m03118 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 310 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +3 Query: 96 LAVPHHSSRAPGS*GPKGAW--PHRELPASSPQPSNEGTS*P 215 +A P +S P P A PH++ P S PQP+N + P Sbjct: 1 MATPSPTSSPPSDSNPNSAATPPHQKQPPSPPQPTNPSSPPP 42 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 28.7 bits (61), Expect = 4.9 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = +1 Query: 46 PNGYQDPKHPEEEVVSNWPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 210 P+ P+ P+E N PY +P+ K RR P P + P+P PP Sbjct: 463 PSPVHKPQPPKESPQPNDPYDQSPV-----KFRRSPPPPPVHSPPPPSPIHSPPP 512 >At3g03950.2 68416.m00414 expressed protein contains Pfam profile PF04146: YT521-B-like family Length = 424 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = +1 Query: 235 MKQKVAESVLQRVVGEEAPKVLHKQFNSPINLYSEQNIANSIR 363 MKQ V+ LQR GE P+ K I YSE ++ N I+ Sbjct: 217 MKQDVSAVDLQRYNGENFPESFVKAKFFVIKSYSEDDVHNCIK 259 >At3g03950.1 68416.m00413 expressed protein contains Pfam profile PF04146: YT521-B-like family Length = 425 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = +1 Query: 235 MKQKVAESVLQRVVGEEAPKVLHKQFNSPINLYSEQNIANSIR 363 MKQ V+ LQR GE P+ K I YSE ++ N I+ Sbjct: 218 MKQDVSAVDLQRYNGENFPESFVKAKFFVIKSYSEDDVHNCIK 260 >At2g28830.1 68415.m03505 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 654 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 248 WQSRCCSEWLAKRHLRCCTSNSTLQS-IYTRNRTLQTL 358 ++ C +WL HL C + TL S I T N L++L Sbjct: 281 YERECIKKWLEGGHLTCPKTQETLTSDIMTPNYVLRSL 318 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,020,168 Number of Sequences: 28952 Number of extensions: 362235 Number of successful extensions: 1027 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 973 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1026 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1863090400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -