BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30770 (781 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40494| Best HMM Match : fn3 (HMM E-Value=9.2e-21) 29 4.2 SB_19405| Best HMM Match : DMP1 (HMM E-Value=3.8) 28 7.4 >SB_40494| Best HMM Match : fn3 (HMM E-Value=9.2e-21) Length = 600 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = -3 Query: 590 KTFFLIRTFFLIYIDFYHKLQNLVNIVAVKAKQKQLLNVS 471 K +L++ FFL+ + FY ++ NL + +V +K +LN S Sbjct: 26 KASYLLKIFFLVIVLFYKEV-NLADAESVDLGEKAVLNCS 64 >SB_19405| Best HMM Match : DMP1 (HMM E-Value=3.8) Length = 551 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 406 PYVVVEFCCEHRPHVTCD*HEH 471 PY+ + CEHRPH+ D +EH Sbjct: 103 PYLASD-SCEHRPHLARDPYEH 123 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,838,362 Number of Sequences: 59808 Number of extensions: 341762 Number of successful extensions: 717 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 717 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2131907602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -