BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30685 (677 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC038233-1|AAH38233.1| 771|Homo sapiens pleckstrin and Sec7 dom... 31 5.0 X05615-1|CAA29104.1| 2767|Homo sapiens thyroglobulin protein. 30 6.6 U93033-1|AAC51924.1| 2768|Homo sapiens thyroglobulin protein. 30 6.6 >BC038233-1|AAH38233.1| 771|Homo sapiens pleckstrin and Sec7 domain containing 2 protein. Length = 771 Score = 30.7 bits (66), Expect = 5.0 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = +3 Query: 108 KTHLDMIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTR 236 KTH DM G+ TP + R W+ F LKG+ ++ YRP + Sbjct: 522 KTHADMDGKR-TPRGR-RGWKKFYAVLKGTILYLQKDEYRPDK 562 >X05615-1|CAA29104.1| 2767|Homo sapiens thyroglobulin protein. Length = 2767 Score = 30.3 bits (65), Expect = 6.6 Identities = 20/62 (32%), Positives = 33/62 (53%) Frame = +3 Query: 129 GRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTRRSVFPELLSTYPYSKSIYDDPIAA 308 G++ TP+K S+ + G+ + + Y ++ VFP +LS YP S+ D P+AA Sbjct: 794 GQDLTPAKLLVKIMSYREAASGNFSLFIQSLYEAGQQDVFP-VLSQYP---SLQDVPLAA 849 Query: 309 AE 314 E Sbjct: 850 LE 851 >U93033-1|AAC51924.1| 2768|Homo sapiens thyroglobulin protein. Length = 2768 Score = 30.3 bits (65), Expect = 6.6 Identities = 20/62 (32%), Positives = 33/62 (53%) Frame = +3 Query: 129 GRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTRRSVFPELLSTYPYSKSIYDDPIAA 308 G++ TP+K S+ + G+ + + Y ++ VFP +LS YP S+ D P+AA Sbjct: 794 GQDLTPAKLLVKIMSYREAASGNFSLFIQSLYEAGQQDVFP-VLSQYP---SLQDVPLAA 849 Query: 309 AE 314 E Sbjct: 850 LE 851 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,565,217 Number of Sequences: 237096 Number of extensions: 1851604 Number of successful extensions: 8288 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8274 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7671262118 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -