BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30682 (783 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 25 0.79 AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 25 0.79 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 2.4 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 25.0 bits (52), Expect = 0.79 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +3 Query: 510 FPSITSQPRSSLDAATSRACTTPVRRPSPTVGHFTRS 620 FP I+ R ++ R P+R P + H+ R+ Sbjct: 102 FPMISVFSRQDIETIIRRNSRYPLRPPQEVISHYRRT 138 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 25.0 bits (52), Expect = 0.79 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 420 ANRSRTVSAMTLTLLSFWCPYAASRIASTIF 512 A ++ V+ M L W PYAA IA+ F Sbjct: 107 AKITKMVALMITAFLLAWSPYAALAIAAQYF 137 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 23.4 bits (48), Expect = 2.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 180 GSGSAHPWSSVSWTESLTDAA 242 G S+H S SWT+ DAA Sbjct: 399 GQSSSHHHGSKSWTQEDMDAA 419 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,645 Number of Sequences: 438 Number of extensions: 4927 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -