BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30676 (725 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_1151 - 9727051-9729510,9733966-9734022,9735299-9735676 29 5.0 07_01_0963 + 8085918-8086225,8086335-8086461,8087134-8087688 28 8.7 >06_01_1151 - 9727051-9729510,9733966-9734022,9735299-9735676 Length = 964 Score = 28.7 bits (61), Expect = 5.0 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +2 Query: 542 MIITASFTALTF*SVSDFEGHTPVILRSDRDISN*IN 652 +I+ +FT L V DF G+T ++ + +++SN IN Sbjct: 678 LILPGTFTKLYHMQVLDFIGNTDLVFSAGKEMSNLIN 714 >07_01_0963 + 8085918-8086225,8086335-8086461,8087134-8087688 Length = 329 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 174 PVKQTTNIKNRWRA*NRSLCSRMRL 100 P + +KNRW A RSL S+ RL Sbjct: 176 PGRSENTVKNRWNATKRSLNSKRRL 200 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,861,380 Number of Sequences: 37544 Number of extensions: 288587 Number of successful extensions: 507 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 506 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1898162308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -