BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30674 (686 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3B9.15c |scp1||sterol regulatory element binding protein Scp... 28 1.5 SPCC1183.04c |pet127||mitochondrial membrane protein Pet127|Schi... 27 3.4 SPAC1610.02c |||mitochondrial ribosomal protein subunit L1|Schiz... 26 4.4 >SPBC3B9.15c |scp1||sterol regulatory element binding protein Scp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1086 Score = 27.9 bits (59), Expect = 1.5 Identities = 18/56 (32%), Positives = 34/56 (60%) Frame = +2 Query: 173 IINSSSTLQKRFSKIYLLSFFIF*IKLYKIPLITLSFCF*LSFFIPFGDNFIAIIT 340 II S S+L K+ +++LSFF++ L + + L+ F +SF + G F+A+++ Sbjct: 338 IIASFSSLLKKLLTLFVLSFFVY--PLVQEFCLFLACSFVVSFLL-HGSFFLAVLS 390 >SPCC1183.04c |pet127||mitochondrial membrane protein Pet127|Schizosaccharomyces pombe|chr 3|||Manual Length = 524 Score = 26.6 bits (56), Expect = 3.4 Identities = 10/28 (35%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +1 Query: 76 RKNIYK-HEC*HRKFNITTCNFRVYDKV 156 R+++Y +C H+ F I +CN + D V Sbjct: 11 RRSVYNLKKCLHKGFQINSCNIKAADNV 38 >SPAC1610.02c |||mitochondrial ribosomal protein subunit L1|Schizosaccharomyces pombe|chr 1|||Manual Length = 253 Score = 26.2 bits (55), Expect = 4.4 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 484 YIYLLNRHLNCFHRRAVMPSMSKRLHSESLTVPIALSYESSISL 615 +I LN+ N +P +K L S S++VP SY SI+L Sbjct: 32 FISQLNKKSNFPALAMTVPEATKYLKSVSISVPYVGSYMLSIAL 75 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,348,883 Number of Sequences: 5004 Number of extensions: 45274 Number of successful extensions: 75 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -