BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30666 (491 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49100.1 68416.m05363 signal recognition particle 9 kDa prote... 69 2e-12 At5g40170.1 68418.m04875 disease resistance family protein conta... 30 0.74 At1g06670.1 68414.m00707 DEIH-box RNA/DNA helicase identical to ... 27 6.9 At4g16950.2 68417.m02557 disease resistance protein (TIR-NBS-LRR... 27 9.1 At4g16950.1 68417.m02556 disease resistance protein (TIR-NBS-LRR... 27 9.1 At4g03190.1 68417.m00436 F-box family protein (FBL18) almost ide... 27 9.1 >At3g49100.1 68416.m05363 signal recognition particle 9 kDa protein, putative / SRP9, putative similar to SP|P49458 Signal recognition particle 9 kDa protein (SRP9) {Homo sapiens}; contains Pfam PF05486: Signal recognition particle 9 kDa protein (SRP9) Length = 103 Score = 68.9 bits (161), Expect = 2e-12 Identities = 28/74 (37%), Positives = 47/74 (63%) Frame = +2 Query: 215 MTFVPNWEEFEKAAEMLYLQDPINTRYSVKYSHSKGAFNVKITDNKKCLQYKTEVQQDVR 394 M ++ +W+EF + L+ DP +TRY +KY H G +K+TDNK+CL++KT+ Q+ + Sbjct: 1 MVYIASWDEFVDRSVQLFRADPESTRYVMKYRHCDGKLVLKVTDNKECLKFKTDQAQEAK 60 Query: 395 KIDKFMSNLLRHMA 436 K++K + MA Sbjct: 61 KMEKLNNIFFTLMA 74 >At5g40170.1 68418.m04875 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-4 [Lycopersicon hirsutum] gi|2808683|emb|CAA05268 Length = 792 Score = 30.3 bits (65), Expect = 0.74 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = -1 Query: 281 LDPVDITFPRLSQTLPNLEQKSLRPIIDYSLEMFLKIVPEYVGTEQYAI 135 L +D+++ +L+ +PNL +L ID S F +P Y+ T + + Sbjct: 165 LTNLDLSYNKLTGGIPNLHSLTLLENIDLSYNKFSGAIPSYLFTMPFLV 213 >At1g06670.1 68414.m00707 DEIH-box RNA/DNA helicase identical to DEIH-box RNA/DNA helicase GB:BAA84364 GI:5881579 [Arabidopsis thaliana] Length = 1576 Score = 27.1 bits (57), Expect = 6.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 176 LKTFLVNSQ*LAVMTFVPNWEEFEKAAEML 265 +K +S+ A++ F+P WEE K E L Sbjct: 566 MKKICSDSKDGAILVFLPGWEEISKTKEKL 595 >At4g16950.2 68417.m02557 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein.; closest homolog in Col-0 to RPP5 of clutivar Landsberg erecta. Length = 1404 Score = 26.6 bits (56), Expect = 9.1 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 272 VDITFPRLSQTLPNLEQKSLRPIIDYSLEMFLKIVPEYV 156 VD+ LS + L+ KS+ ID+ +E I PE + Sbjct: 21 VDVRKTFLSHLIEALDGKSINTFIDHGIERSRTIAPELI 59 >At4g16950.1 68417.m02556 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein.; closest homolog in Col-0 to RPP5 of clutivar Landsberg erecta. Length = 1449 Score = 26.6 bits (56), Expect = 9.1 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 272 VDITFPRLSQTLPNLEQKSLRPIIDYSLEMFLKIVPEYV 156 VD+ LS + L+ KS+ ID+ +E I PE + Sbjct: 21 VDVRKTFLSHLIEALDGKSINTFIDHGIERSRTIAPELI 59 >At4g03190.1 68417.m00436 F-box family protein (FBL18) almost identical to GRR1-like protein 1 GI:12658970 from [Arabidopsis thaliana]; similar to leucine-rich repeats containing F-box protein FBL3 (GI:5919219) [Homo sapiens]; similar to F-box protein FBL2 (GI:6063090) [Homo sapiens] Length = 585 Score = 26.6 bits (56), Expect = 9.1 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -3 Query: 345 SVILTLNAPFECEYLTLYRVFIGSCRYNISAA 250 SV L + FE E T RVF+G+C Y +S A Sbjct: 25 SVSLVCKSWFETERKTRKRVFVGNC-YAVSPA 55 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,944,456 Number of Sequences: 28952 Number of extensions: 173188 Number of successful extensions: 327 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 324 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 327 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 858708096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -