BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30664 (780 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) 87 3e-32 SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) 25 2.3 SB_8527| Best HMM Match : zf-C2H2 (HMM E-Value=4.3e-21) 30 2.4 SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_59380| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) 28 7.4 SB_20312| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_6613| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_605| Best HMM Match : Calx-beta (HMM E-Value=0) 28 9.8 >SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) Length = 710 Score = 86.6 bits (205), Expect(2) = 3e-32 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +3 Query: 78 SGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKV 212 SGAS T+P QCS+LRKNG V++KGRPCKIVEMSTSKTGKHGHAKV Sbjct: 600 SGASDTYPAQCSSLRKNGHVVIKGRPCKIVEMSTSKTGKHGHAKV 644 Score = 70.5 bits (165), Expect(2) = 3e-32 Identities = 29/62 (46%), Positives = 44/62 (70%) Frame = +3 Query: 312 QLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLRTDFDSGKELLCTVLKSCGEECVIA 491 ++T+I +DGYL LM DNGD R D+K+ D D+ ++R F++ + + TVLK+ GEE V+ Sbjct: 643 KVTNIEEDGYLELMDDNGDTRADIKLQDNDIAKEIRAKFEASENFMVTVLKAMGEETVVG 702 Query: 492 VK 497 VK Sbjct: 703 VK 704 >SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) Length = 458 Score = 24.6 bits (51), Expect(2) = 2.3 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +1 Query: 97 SPCNVRPCVKTVSLC*RVVHARLLKCPHPKPESTATLKFTWLGLISSMVKSMK 255 +PC ++ C + +S+ V ++K P P TL ++G + +K +K Sbjct: 398 NPCRIQYCTQEISMTPIHVLLLIVKAPILDPSLVVTLCSRFIGHQARKLKIVK 450 Score = 23.8 bits (49), Expect(2) = 2.3 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 79 PGPQPPSPCNVRP 117 PGPQ P P N+ P Sbjct: 362 PGPQDPGPGNILP 374 >SB_8527| Best HMM Match : zf-C2H2 (HMM E-Value=4.3e-21) Length = 1049 Score = 29.9 bits (64), Expect = 2.4 Identities = 19/70 (27%), Positives = 31/70 (44%), Gaps = 3/70 (4%) Frame = -3 Query: 544 NPINAELVYLSRAVF---ALTAMTHSSPQDFSTVHNNSLPLSKSVRNCVPRSPSGILRSS 374 NP L Y + A+F + A S QD+ +H NS + N +P+ S I ++ Sbjct: 69 NPSFGPLNYATMAIFPPNTVPAPPQDSTQDYREIHTNSFYFQHQMSNTLPKEES-IQQAD 127 Query: 373 RRSPLSAIRV 344 +P + V Sbjct: 128 ESAPHDILSV 137 >SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +3 Query: 123 KNGFVMLKGRPCKIV-EMSTSKTGKHGHAKVHLVGIDIFNG 242 + G +M +G+PCKI + K G HG +H+ G D NG Sbjct: 17 RRGVMMAEGKPCKITGTIEGLKAGNHGF-HIHVYG-DNTNG 55 >SB_59380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1226 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -1 Query: 744 GLRARLRNASAK*GGEVLRVTSARGR 667 G R+R+AS K GGE + + SA GR Sbjct: 334 GCNLRIRSASPKDGGEYMCIVSASGR 359 >SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1671 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +3 Query: 237 NGKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNG 365 NG Y CP N D + EDY + D YLT D G Sbjct: 400 NGHTYHMTCPGQTNFDPAKKRCEDYDCSG-RDVAYLTDQNDGG 441 >SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1438 Score = 28.7 bits (61), Expect = 5.6 Identities = 21/84 (25%), Positives = 37/84 (44%) Frame = +3 Query: 264 PSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLRTDFDSGKE 443 P + + V + +++ D + ADN + RE+ + +L ++ T G Sbjct: 284 PESDGIRVDETENGEHEAVDELPEDKPDTEADNYEQREETPTKEDELKSECTTSDSEGTP 343 Query: 444 LLCTVLKSCGEECVIAVKANTALD 515 T KS GEE V A ++ +LD Sbjct: 344 SAATYGKSDGEENV-AQESEESLD 366 >SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) Length = 492 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = -3 Query: 472 PQDFSTVHNNSLPLSKSVRNCVPRSPSGILRSSRRSPLSAIRVR 341 P+ S V + +LP+ V C+P SPS I RS P VR Sbjct: 253 PRQISNVRSLTLPVRYQVIGCLP-SPSDIKRSVPYPPRQISNVR 295 >SB_20312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = -3 Query: 553 KFVNPINAELVY---LSRAVFALTAMTHSSPQDFSTVHNNSLPLSKSVRNC 410 KF++P +A + +R+ + T M+H SP + +T + KS R C Sbjct: 23 KFIDPTSARISNQKAANRSQQSATQMSHKSPTNCTTCRMSDFSAGKSRREC 73 >SB_6613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 27.9 bits (59), Expect = 9.8 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 4/72 (5%) Frame = +3 Query: 279 MDVPHVKREDYQLTDISDDGYLT----LMADNGDLREDLKIPDGDLGTQLRTDFDSGKEL 446 +D+P+ K + + L ++DD L+ + D L E L PD + R D G E Sbjct: 37 LDIPYEKYDKFDLESLTDDECLSEFRFIKNDLYRLNEALNFPD-QITCPNRLTVD-GMEA 94 Query: 447 LCTVLKSCGEEC 482 LC L+ C Sbjct: 95 LCMTLRRFAYPC 106 >SB_605| Best HMM Match : Calx-beta (HMM E-Value=0) Length = 1958 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -1 Query: 87 RPRSSGLEVCVFDVTHCCVLNLTTV 13 +P SS + + +F VT+CC L LT + Sbjct: 8 QPPSSTVNLIIFTVTNCCFLVLTAL 32 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,814,859 Number of Sequences: 59808 Number of extensions: 564279 Number of successful extensions: 1489 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1335 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1485 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2131907602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -