BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30662 (562 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36475| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.28 SB_44949| Best HMM Match : LIM (HMM E-Value=0.44) 31 0.85 SB_32075| Best HMM Match : LIM (HMM E-Value=0.44) 31 0.85 SB_29289| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_30355| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_2876| Best HMM Match : Peptidase_C2 (HMM E-Value=2.8) 30 1.5 SB_33051| Best HMM Match : PADR1 (HMM E-Value=1.2) 29 2.0 SB_13306| Best HMM Match : PADR1 (HMM E-Value=1.2) 29 2.0 SB_28573| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_56953| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_56579| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_56193| Best HMM Match : RolB_RolC (HMM E-Value=5.3) 29 2.6 SB_53418| Best HMM Match : zf-CCHC (HMM E-Value=8.2) 29 2.6 SB_53010| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_51278| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_50679| Best HMM Match : Tombus_P19 (HMM E-Value=2.1) 29 2.6 SB_49438| Best HMM Match : LIM (HMM E-Value=3.1) 29 2.6 SB_48331| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_46840| Best HMM Match : S-methyl_trans (HMM E-Value=4.2) 29 2.6 SB_46403| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_43440| Best HMM Match : PADR1 (HMM E-Value=0.45) 29 2.6 SB_42255| Best HMM Match : DUF1131 (HMM E-Value=7.6) 29 2.6 SB_41792| Best HMM Match : DUF495 (HMM E-Value=1.5) 29 2.6 SB_41458| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_40544| Best HMM Match : CBM_5_12 (HMM E-Value=8.9) 29 2.6 SB_39895| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_35739| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_35441| Best HMM Match : ResIII (HMM E-Value=0.078) 29 2.6 SB_34067| Best HMM Match : SPAN-X (HMM E-Value=2.7) 29 2.6 SB_32248| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_31605| Best HMM Match : ResIII (HMM E-Value=0.44) 29 2.6 SB_29680| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_28291| Best HMM Match : DUF1131 (HMM E-Value=2.3) 29 2.6 SB_28107| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_25787| Best HMM Match : Asparaginase_2 (HMM E-Value=0.097) 29 2.6 SB_25687| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_25225| Best HMM Match : DEAD (HMM E-Value=1.4) 29 2.6 SB_23746| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_23736| Best HMM Match : Rhabdo_NV (HMM E-Value=7.1) 29 2.6 SB_23498| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_22826| Best HMM Match : F5_F8_type_C (HMM E-Value=7.9e-09) 29 2.6 SB_21356| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_17591| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_17486| Best HMM Match : CheR (HMM E-Value=3.2) 29 2.6 SB_17334| Best HMM Match : WD40 (HMM E-Value=3.1e-30) 29 2.6 SB_15632| Best HMM Match : CBM_5_12 (HMM E-Value=2.9) 29 2.6 SB_14541| Best HMM Match : ResIII (HMM E-Value=0.66) 29 2.6 SB_13337| Best HMM Match : DUF385 (HMM E-Value=4.7) 29 2.6 SB_9992| Best HMM Match : Dyp_perox (HMM E-Value=5.1) 29 2.6 SB_7068| Best HMM Match : ResIII (HMM E-Value=0.29) 29 2.6 SB_6134| Best HMM Match : DUF1099 (HMM E-Value=5.5) 29 2.6 SB_4087| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_366| Best HMM Match : ResIII (HMM E-Value=0.28) 29 2.6 SB_59743| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_59553| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_59371| Best HMM Match : Ribosomal_L27 (HMM E-Value=0.61) 29 2.6 SB_58059| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_54244| Best HMM Match : Toxin_24 (HMM E-Value=1.7) 29 2.6 SB_53156| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_51489| Best HMM Match : Rhabdo_NV (HMM E-Value=8.6) 29 2.6 SB_49754| Best HMM Match : DUF1281 (HMM E-Value=5.9) 29 2.6 SB_45979| Best HMM Match : XdhC_CoxI (HMM E-Value=6) 29 2.6 SB_45955| Best HMM Match : SMC_hinge (HMM E-Value=2) 29 2.6 SB_45084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_44861| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_44503| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_43547| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_42858| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_42053| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_39579| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_38419| Best HMM Match : ResIII (HMM E-Value=0.48) 29 2.6 SB_37597| Best HMM Match : ResIII (HMM E-Value=0.28) 29 2.6 SB_36328| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6) 29 2.6 SB_31820| Best HMM Match : CG-1 (HMM E-Value=2.4) 29 2.6 SB_31538| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_30246| Best HMM Match : IspA (HMM E-Value=0.39) 29 2.6 SB_29335| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_27173| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_24587| Best HMM Match : ResIII (HMM E-Value=0.82) 29 2.6 SB_24250| Best HMM Match : ResIII (HMM E-Value=3.6) 29 2.6 SB_23457| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_23438| Best HMM Match : zf-CCHC (HMM E-Value=0.00065) 29 2.6 SB_21674| Best HMM Match : LIM (HMM E-Value=0.44) 29 2.6 SB_17392| Best HMM Match : DUF385 (HMM E-Value=1.1) 29 2.6 SB_16849| Best HMM Match : RmlD_sub_bind (HMM E-Value=3.3) 29 2.6 SB_13172| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_12717| Best HMM Match : CheR (HMM E-Value=5.6) 29 2.6 SB_12136| Best HMM Match : ResIII (HMM E-Value=0.24) 29 2.6 SB_9087| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_4780| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_3854| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_2770| Best HMM Match : ResIII (HMM E-Value=2.2) 29 2.6 SB_1431| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_42687| Best HMM Match : UPF0262 (HMM E-Value=2.1) 29 3.4 SB_56507| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_50438| Best HMM Match : Dyp_perox (HMM E-Value=5.1) 29 3.4 SB_31030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_30614| Best HMM Match : DUF1265 (HMM E-Value=3.9) 29 3.4 SB_9956| Best HMM Match : Polysacc_deac_1 (HMM E-Value=4.1) 29 3.4 SB_55623| Best HMM Match : ResIII (HMM E-Value=0.17) 28 4.5 SB_32998| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_24603| Best HMM Match : GatB_Yqey (HMM E-Value=0.7) 28 4.5 SB_14195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_8103| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_5592| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_55881| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_47012| Best HMM Match : ScdA_N (HMM E-Value=5.3) 28 4.5 SB_27311| Best HMM Match : DEAD (HMM E-Value=0.17) 28 4.5 SB_11769| Best HMM Match : Complex1_17_2kD (HMM E-Value=6.6) 28 4.5 SB_53550| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_47810| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_44112| Best HMM Match : PA14 (HMM E-Value=5e-05) 28 6.0 SB_36584| Best HMM Match : ResIII (HMM E-Value=0.95) 28 6.0 SB_9766| Best HMM Match : DUF291 (HMM E-Value=4.3) 28 6.0 SB_8697| Best HMM Match : DUF1131 (HMM E-Value=4.2) 28 6.0 SB_7382| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_42615| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_42004| Best HMM Match : 7tm_1 (HMM E-Value=9.3e-06) 28 6.0 SB_27423| Best HMM Match : ResIII (HMM E-Value=0.56) 28 6.0 SB_3147| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_2065| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_57402| Best HMM Match : DEAD (HMM E-Value=0.42) 27 7.9 SB_40361| Best HMM Match : ResIII (HMM E-Value=0.42) 27 7.9 SB_37849| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_29698| Best HMM Match : DUF1610 (HMM E-Value=4.6) 27 7.9 SB_27946| Best HMM Match : DEAD (HMM E-Value=0.42) 27 7.9 SB_23543| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) 27 7.9 SB_20530| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_10218| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_9872| Best HMM Match : ResIII (HMM E-Value=0.36) 27 7.9 SB_9659| Best HMM Match : ResIII (HMM E-Value=0.39) 27 7.9 SB_3753| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_59747| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_53226| Best HMM Match : ResIII (HMM E-Value=0.45) 27 7.9 SB_53060| Best HMM Match : ResIII (HMM E-Value=0.14) 27 7.9 SB_51306| Best HMM Match : Peptidase_C27 (HMM E-Value=0.78) 27 7.9 SB_48412| Best HMM Match : ResIII (HMM E-Value=0.19) 27 7.9 SB_48295| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_46041| Best HMM Match : LIM (HMM E-Value=1.5) 27 7.9 SB_44056| Best HMM Match : Fumerase_C (HMM E-Value=4.5) 27 7.9 SB_40200| Best HMM Match : Ribosomal_L27 (HMM E-Value=2.6) 27 7.9 SB_34841| Best HMM Match : ResIII (HMM E-Value=1.6) 27 7.9 SB_31859| Best HMM Match : DUF1131 (HMM E-Value=4.3) 27 7.9 SB_24707| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_21729| Best HMM Match : Ribosomal_L27 (HMM E-Value=5.7) 27 7.9 SB_20407| Best HMM Match : ResIII (HMM E-Value=0.36) 27 7.9 SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) 27 7.9 SB_7073| Best HMM Match : ResIII (HMM E-Value=0.083) 27 7.9 SB_5505| Best HMM Match : ResIII (HMM E-Value=0.55) 27 7.9 SB_1076| Best HMM Match : Phage_tail_S (HMM E-Value=2.7) 27 7.9 SB_204| Best HMM Match : ResIII (HMM E-Value=1.2) 27 7.9 >SB_36475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1315 Score = 32.3 bits (70), Expect = 0.28 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP*RSGLW 104 RR +W H V + + LRR++RRIP LW Sbjct: 942 RRSQWYHIRAFVLAYTNIALRRMLRRIPREDVLW 975 >SB_44949| Best HMM Match : LIM (HMM E-Value=0.44) Length = 595 Score = 30.7 bits (66), Expect = 0.85 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H +V + + LRR++RRIP Sbjct: 52 RRSQWYHIRAIVMANTNIALRRMLRRIP 79 >SB_32075| Best HMM Match : LIM (HMM E-Value=0.44) Length = 789 Score = 30.7 bits (66), Expect = 0.85 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H +V + + LRR++RRIP Sbjct: 229 RRSQWYHIRAIVMANTNIALRRMLRRIP 256 >SB_29289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 956 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP*R 92 RR +W H V + + LRR++RRIP R Sbjct: 623 RRSQWYHIRAFVLAHTDIALRRMLRRIPPR 652 >SB_30355| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1067 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 662 RRSQWYHIRAFVLANTNIALRRMLRRIP 689 >SB_2876| Best HMM Match : Peptidase_C2 (HMM E-Value=2.8) Length = 947 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H +V + + LRR++RRIP Sbjct: 581 RRSQWYHIRALVLTYTNIALRRMLRRIP 608 >SB_33051| Best HMM Match : PADR1 (HMM E-Value=1.2) Length = 1066 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR RW H V + I + LR ++RRIP Sbjct: 477 RRSRWYHITAFVLAYINIALRPMLRRIP 504 >SB_13306| Best HMM Match : PADR1 (HMM E-Value=1.2) Length = 967 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR RW H V + I + LR ++RRIP Sbjct: 378 RRSRWYHITAFVLAYINIALRPMLRRIP 405 >SB_28573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H + V + + LRR++RRIP Sbjct: 75 RRSQWYHIKAFVLAYTNIALRRMLRRIP 102 >SB_56953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 749 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 308 RRSQWYHIRAFVLAYTNIALRRMLRRIP 335 >SB_56579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1042 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 620 RRSQWYHIRAFVLAYTNIALRRMLRRIP 647 >SB_56193| Best HMM Match : RolB_RolC (HMM E-Value=5.3) Length = 337 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 189 RRSQWYHIRAFVLAYTNIALRRMLRRIP 216 >SB_53418| Best HMM Match : zf-CCHC (HMM E-Value=8.2) Length = 196 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 97 RRSQWYHIRAFVLAYTNIALRRMLRRIP 124 >SB_53010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 787 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 703 RRSQWYHIRAFVLAYTNIALRRMLRRIP 730 >SB_51278| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 406 RRSQWYHIRAFVLAYTNIALRRMLRRIP 433 >SB_50679| Best HMM Match : Tombus_P19 (HMM E-Value=2.1) Length = 330 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 97 RRSQWYHIRAFVLAYTNIALRRMLRRIP 124 >SB_49438| Best HMM Match : LIM (HMM E-Value=3.1) Length = 355 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 52 RRSQWYHIRAFVLAYTNIALRRMLRRIP 79 >SB_48331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 52 RRSQWYHIRAFVLAYTNIALRRMLRRIP 79 >SB_46840| Best HMM Match : S-methyl_trans (HMM E-Value=4.2) Length = 774 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 647 RRSQWYHIRAFVLAYTNIALRRMLRRIP 674 >SB_46403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 459 RRSQWYHIRAFVLAYTNIALRRMLRRIP 486 >SB_43440| Best HMM Match : PADR1 (HMM E-Value=0.45) Length = 942 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 627 RRSQWYHIRAFVLAYTNIALRRMLRRIP 654 >SB_42255| Best HMM Match : DUF1131 (HMM E-Value=7.6) Length = 235 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 169 RRSQWYHIRAFVLAYTNIALRRMLRRIP 196 >SB_41792| Best HMM Match : DUF495 (HMM E-Value=1.5) Length = 835 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 653 RRSQWYHIRAFVLAYTNIALRRMLRRIP 680 >SB_41458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 922 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 642 RRSQWYHIRAFVLAYTNIALRRMLRRIP 669 >SB_40544| Best HMM Match : CBM_5_12 (HMM E-Value=8.9) Length = 520 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 454 RRSQWYHIRAFVLAYTNIALRRMLRRIP 481 >SB_39895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 142 RRSQWYHIRAFVLAYTNIALRRMLRRIP 169 >SB_35739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 654 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 370 RRSQWYHIRAFVLAYTNIALRRMLRRIP 397 >SB_35441| Best HMM Match : ResIII (HMM E-Value=0.078) Length = 767 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 278 RRSQWYHIRAFVLAYTNIALRRMLRRIP 305 >SB_34067| Best HMM Match : SPAN-X (HMM E-Value=2.7) Length = 207 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 15 RRSQWYHIRAFVLAYTNIALRRMLRRIP 42 >SB_32248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1023 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 650 RRSQWYHIRAFVLAYTNIALRRMLRRIP 677 >SB_31605| Best HMM Match : ResIII (HMM E-Value=0.44) Length = 488 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 52 RRSQWYHIRAFVLAYTNIALRRMLRRIP 79 >SB_29680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1194 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 719 RRSQWYHIRAFVLAYTNIALRRMLRRIP 746 >SB_28291| Best HMM Match : DUF1131 (HMM E-Value=2.3) Length = 421 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 195 RRSQWYHIRAFVLAYTNIALRRMLRRIP 222 >SB_28107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1037 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 528 RRSQWYHIRAFVLAYTNIALRRMLRRIP 555 >SB_25787| Best HMM Match : Asparaginase_2 (HMM E-Value=0.097) Length = 1623 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 927 RRSQWYHIRAFVLAYTNIALRRMLRRIP 954 >SB_25687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 877 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 355 RRSQWYHIRAFVLAYTNIALRRMLRRIP 382 >SB_25225| Best HMM Match : DEAD (HMM E-Value=1.4) Length = 534 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 241 RRSQWYHIRAFVLAYTNIALRRMLRRIP 268 >SB_23746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 273 RRSQWYHIRAFVLAYTNIALRRMLRRIP 300 >SB_23736| Best HMM Match : Rhabdo_NV (HMM E-Value=7.1) Length = 157 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 91 RRSQWYHIRAFVLAYTNIALRRMLRRIP 118 >SB_23498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 661 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 493 RRSQWYHIRAFVLAYTNIALRRMLRRIP 520 >SB_22826| Best HMM Match : F5_F8_type_C (HMM E-Value=7.9e-09) Length = 1296 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 1042 RRSQWYHIRAFVLAYTNIALRRMLRRIP 1069 >SB_21356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1003 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 588 RRSQWYHIRAFVLAYTNIALRRMLRRIP 615 >SB_17591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 567 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 342 RRSQWYHIRAFVLAYTNIALRRMLRRIP 369 >SB_17486| Best HMM Match : CheR (HMM E-Value=3.2) Length = 1177 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 704 RRSQWYHIRAFVLAYTNIALRRMMRRIP 731 >SB_17334| Best HMM Match : WD40 (HMM E-Value=3.1e-30) Length = 1292 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 844 RRSQWYHIRAFVLAYTNIALRRMLRRIP 871 >SB_15632| Best HMM Match : CBM_5_12 (HMM E-Value=2.9) Length = 748 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 600 RRSQWYHIRAFVLAYTNIALRRMLRRIP 627 >SB_14541| Best HMM Match : ResIII (HMM E-Value=0.66) Length = 822 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 412 RRSQWYHIRAFVLAYTNIALRRMLRRIP 439 >SB_13337| Best HMM Match : DUF385 (HMM E-Value=4.7) Length = 172 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 124 RRSQWYHIRAFVLAYTNIALRRMLRRIP 151 >SB_9992| Best HMM Match : Dyp_perox (HMM E-Value=5.1) Length = 391 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 243 RRSQWYHIRAFVLAYTNIALRRMLRRIP 270 >SB_7068| Best HMM Match : ResIII (HMM E-Value=0.29) Length = 1131 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 704 RRSQWYHIRAFVLAYTNIALRRMLRRIP 731 >SB_6134| Best HMM Match : DUF1099 (HMM E-Value=5.5) Length = 743 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 482 RRSQWYHIRAFVLAYTNIALRRMLRRIP 509 >SB_4087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1095 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 600 RRSQWYHIRAFVLAYTNIALRRMLRRIP 627 >SB_366| Best HMM Match : ResIII (HMM E-Value=0.28) Length = 1104 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 700 RRSQWYHIRAFVLAYTNIALRRMLRRIP 727 >SB_59743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 957 RRSQWYHIRAFVLAYTNIALRRMLRRIP 984 >SB_59553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1003 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 457 RRSQWYHIRAFVLAYTNIALRRMLRRIP 484 >SB_59371| Best HMM Match : Ribosomal_L27 (HMM E-Value=0.61) Length = 376 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 273 RRSQWYHIRAFVLAYTNIALRRMLRRIP 300 >SB_58059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 993 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 482 RRSQWYHIRAFVLAYTNIALRRMLRRIP 509 >SB_54244| Best HMM Match : Toxin_24 (HMM E-Value=1.7) Length = 513 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 398 RRSQWYHIRSFVLAYTNIALRRMLRRIP 425 >SB_53156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 646 RRSQWYHIRAFVLAYTNIALRRMLRRIP 673 >SB_51489| Best HMM Match : Rhabdo_NV (HMM E-Value=8.6) Length = 201 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 135 RRSQWYHIRAFVLAYTNIALRRMLRRIP 162 >SB_49754| Best HMM Match : DUF1281 (HMM E-Value=5.9) Length = 338 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 182 RRSQWYHIRAFVLAYTNIALRRMLRRIP 209 >SB_45979| Best HMM Match : XdhC_CoxI (HMM E-Value=6) Length = 649 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 467 RRSQWYHIRAFVLAYTNIALRRMLRRIP 494 >SB_45955| Best HMM Match : SMC_hinge (HMM E-Value=2) Length = 665 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 374 RRSQWYHIRAFVLAYTNIALRRMLRRIP 401 >SB_45084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 176 RRSQWYHIRAFVLAYTNIALRRMLRRIP 203 >SB_44861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 810 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 310 RRSQWYHIRAFVLAYTNIALRRMLRRIP 337 >SB_44503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1347 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 899 RRSQWYHIRAFVLAYTNIALRRMLRRIP 926 >SB_43547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 350 RRSQWYHIRAFVLAYTNIALRRMLRRIP 377 >SB_42858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 953 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 643 RRSQWYHIRAFVLAYTNIALRRMLRRIP 670 >SB_42053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 52 RRSQWYHIRAFVLAYTNIALRRMLRRIP 79 >SB_39579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 490 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 322 RRSQWYHIRAFVLTYTNIALRRMLRRIP 349 >SB_38419| Best HMM Match : ResIII (HMM E-Value=0.48) Length = 385 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 97 RRSQWYHIRAFVLTYTNIALRRMLRRIP 124 >SB_37597| Best HMM Match : ResIII (HMM E-Value=0.28) Length = 658 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 189 RRSQWYHIRAFVLAYTNIALRRMLRRIP 216 >SB_36328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1526 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 1252 RRSQWYHIRAFVLAYTNIALRRMLRRIP 1279 >SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2492 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 2445 RRSQWYHIRAFVLAYTNIALRRMLRRIP 2472 >SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6) Length = 1053 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 407 RRSQWYHIRAFVLAYTNIALRRMLRRIP 434 >SB_31820| Best HMM Match : CG-1 (HMM E-Value=2.4) Length = 992 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 542 RRSQWYHIRAFVLAYTNIALRRMLRRIP 569 >SB_31538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 195 RRSQWYHIRAFVLAYTNIALRRMLRRIP 222 >SB_30246| Best HMM Match : IspA (HMM E-Value=0.39) Length = 1502 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 1138 RRSQWYHIRAFVLAYTNIALRRMLRRIP 1165 >SB_29335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 840 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 345 RRSQWYHIRAFVLAYTNIALRRMLRRIP 372 >SB_27173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1206 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 685 RRSQWYHIRAFVLAYTNIALRRMLRRIP 712 >SB_24587| Best HMM Match : ResIII (HMM E-Value=0.82) Length = 250 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 39 RRSQWYHIRAFVLAYTNIALRRMLRRIP 66 >SB_24250| Best HMM Match : ResIII (HMM E-Value=3.6) Length = 842 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 601 RRSQWYHIRAFVLAYTNIALRRMLRRIP 628 >SB_23457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 437 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 139 RRSQWYHIRAFVLAYTNIALRRMLRRIP 166 >SB_23438| Best HMM Match : zf-CCHC (HMM E-Value=0.00065) Length = 1275 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 352 RRSQWYHIRAFVLAYTNIALRRMLRRIP 379 >SB_21674| Best HMM Match : LIM (HMM E-Value=0.44) Length = 885 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 480 RRSQWYHIRAFVLAYTNIALRRMLRRIP 507 >SB_17392| Best HMM Match : DUF385 (HMM E-Value=1.1) Length = 942 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 568 RRSQWYHIRAFVLAYTNIALRRMLRRIP 595 >SB_16849| Best HMM Match : RmlD_sub_bind (HMM E-Value=3.3) Length = 355 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 97 RRSQWYHIRAFVLAYTNIALRRMLRRIP 124 >SB_13172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 599 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 195 RRSQWYHIRAFVLAYTNIALRRMLRRIP 222 >SB_12717| Best HMM Match : CheR (HMM E-Value=5.6) Length = 685 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 428 RRSQWYHIRAFVLAYTNIALRRMLRRIP 455 >SB_12136| Best HMM Match : ResIII (HMM E-Value=0.24) Length = 1118 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 736 RRSQWYHIRAFVLAYTNIALRRMLRRIP 763 >SB_9087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 599 RRSQWYHIRAFVLAYTNIALRRILRRIP 626 >SB_4780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 799 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 651 RRSQWYHIRAFVLAYTNIALRRMLRRIP 678 >SB_3854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 726 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 487 RRSQWYHIRAFVLAYTNIALRRMLRRIP 514 >SB_2770| Best HMM Match : ResIII (HMM E-Value=2.2) Length = 928 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 485 RRSQWYHIRAFVLAYTNIALRRMLRRIP 512 >SB_1431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1748 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 1311 RRSQWYHIRAFVLAYTNIALRRMLRRIP 1338 >SB_42687| Best HMM Match : UPF0262 (HMM E-Value=2.1) Length = 908 Score = 28.7 bits (61), Expect = 3.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 383 RRSQWYHIRAFVLAFTNIALRRMLRRIP 410 >SB_56507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 782 Score = 28.7 bits (61), Expect = 3.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 600 RRSQWYHIRAFVLAYTNVALRRMLRRIP 627 >SB_50438| Best HMM Match : Dyp_perox (HMM E-Value=5.1) Length = 604 Score = 28.7 bits (61), Expect = 3.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 428 RRSQWYHIRAFVLAYTNVALRRMLRRIP 455 >SB_31030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1009 Score = 28.7 bits (61), Expect = 3.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + +L LRR++RR P Sbjct: 535 RRSQWYHIRAFVLAYTKLALRRMLRRFP 562 >SB_30614| Best HMM Match : DUF1265 (HMM E-Value=3.9) Length = 327 Score = 28.7 bits (61), Expect = 3.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 95 RRSQWYHIRAYVLAYTNIALRRMLRRIP 122 >SB_9956| Best HMM Match : Polysacc_deac_1 (HMM E-Value=4.1) Length = 586 Score = 28.7 bits (61), Expect = 3.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 532 RRSQWYHIRAYVLAYTNIALRRMLRRIP 559 >SB_55623| Best HMM Match : ResIII (HMM E-Value=0.17) Length = 755 Score = 28.3 bits (60), Expect = 4.5 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H +V + + LRR++RRIP Sbjct: 242 RRSQWHHIRDIVLAYTNIALRRMLRRIP 269 >SB_32998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 677 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -1 Query: 142 CDRHSPDHRIHDHHSPDRYGILRTSRRSPSCILDSTIRSGCSQ 14 C +HS D + HS D G + +R + C S +GC++ Sbjct: 624 CVKHSRDAKGRVKHSRDATGCAKNTRDATGCAKHSREPTGCAK 666 >SB_24603| Best HMM Match : GatB_Yqey (HMM E-Value=0.7) Length = 984 Score = 28.3 bits (60), Expect = 4.5 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR+ RRIP Sbjct: 447 RRSQWYHIRAFVLAYTNIALRRMFRRIP 474 >SB_14195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 28.3 bits (60), Expect = 4.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 185 RRSQWYHIRAFVLAYKNIALRRMLRRIP 212 >SB_8103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1071 Score = 28.3 bits (60), Expect = 4.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 617 RRSQWHHIRAFVLAYTNIALRRMLRRIP 644 >SB_5592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1092 Score = 28.3 bits (60), Expect = 4.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 640 RRSQWYHIRAFVLAYKNIALRRMLRRIP 667 >SB_55881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 874 Score = 28.3 bits (60), Expect = 4.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 399 RRSQWYHIRAFVLAYKNIALRRMLRRIP 426 >SB_47012| Best HMM Match : ScdA_N (HMM E-Value=5.3) Length = 840 Score = 28.3 bits (60), Expect = 4.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 619 RRSQWHHIRAFVLAYTNIALRRMLRRIP 646 >SB_27311| Best HMM Match : DEAD (HMM E-Value=0.17) Length = 1178 Score = 28.3 bits (60), Expect = 4.5 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H +V + + LRR++RR P Sbjct: 609 RRSQWYHIRALVLAYTNIALRRMLRRFP 636 >SB_11769| Best HMM Match : Complex1_17_2kD (HMM E-Value=6.6) Length = 355 Score = 28.3 bits (60), Expect = 4.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 161 RRSQWNHIRAFVLAYTNIALRRMLRRIP 188 >SB_53550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 27.9 bits (59), Expect = 6.0 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR +RRIP Sbjct: 673 RRSQWYHIRAFVLAYTNIALRRTLRRIP 700 >SB_47810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 27.9 bits (59), Expect = 6.0 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 91 RRSKWYHIRAFVLAYTNIALRRMLRRFP 118 >SB_44112| Best HMM Match : PA14 (HMM E-Value=5e-05) Length = 1433 Score = 27.9 bits (59), Expect = 6.0 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 926 RRSQWYHIRAFVLAYTNIVLRRMLRRIP 953 >SB_36584| Best HMM Match : ResIII (HMM E-Value=0.95) Length = 1244 Score = 27.9 bits (59), Expect = 6.0 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR+++RIP Sbjct: 672 RRSQWYHIRAFVLAYTNIALRRMLKRIP 699 >SB_9766| Best HMM Match : DUF291 (HMM E-Value=4.3) Length = 604 Score = 27.9 bits (59), Expect = 6.0 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 127 PDHRIHDHHSPDRYGILRTSR 65 PDH H SPDRYG RT + Sbjct: 2 PDH--HQDQSPDRYGSTRTKK 20 >SB_8697| Best HMM Match : DUF1131 (HMM E-Value=4.2) Length = 286 Score = 27.9 bits (59), Expect = 6.0 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 R RW H V + + LRR++RRIP Sbjct: 195 RGSRWYHIRAFVLAYTNIALRRMLRRIP 222 >SB_7382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1120 Score = 27.9 bits (59), Expect = 6.0 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR W H V + + LRR++RRIP Sbjct: 575 RRSPWYHIRAFVLAYANIALRRILRRIP 602 >SB_42615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1130 Score = 27.9 bits (59), Expect = 6.0 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RRIP Sbjct: 658 RRSQWYHIRAFVLAYTIIALRRMLRRIP 685 >SB_42004| Best HMM Match : 7tm_1 (HMM E-Value=9.3e-06) Length = 386 Score = 27.9 bits (59), Expect = 6.0 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +3 Query: 264 NSWIHHNFYTVFAVTQCIDARVFVIICLRHFKYSLSFVT 380 +SWI N VFA++ C+ VF R F+ L +T Sbjct: 280 HSWIVRNVNAVFALSNCVFIPVFSFANNRQFRVVLMRLT 318 >SB_27423| Best HMM Match : ResIII (HMM E-Value=0.56) Length = 562 Score = 27.9 bits (59), Expect = 6.0 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 189 RRSQWYHVRAFVLAYTNIALRRMLRRFP 216 >SB_3147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 27.9 bits (59), Expect = 6.0 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Frame = +3 Query: 261 VNSWI---HHNFYTVF-AVTQCIDARVFVIICLRHFKYSLSFVTRIHIKTRI 404 +N WI HH TV VTQ DA+ F +I + + + T +H R+ Sbjct: 91 LNKWIKREHHYTKTVDEVVTQLCDAKYFTLIDAKKGTGTFPWTTEVHTSQRL 142 >SB_2065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 619 Score = 27.9 bits (59), Expect = 6.0 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR+++RIP Sbjct: 195 RRSQWYHIRAFVLAYTNIALRRMLKRIP 222 >SB_57402| Best HMM Match : DEAD (HMM E-Value=0.42) Length = 428 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 91 RRSQWYHIRAFVLAYTNIALRRMLRRFP 118 >SB_40361| Best HMM Match : ResIII (HMM E-Value=0.42) Length = 1127 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 457 RRSQWYHIRAFVLAYTNIALRRMLRRFP 484 >SB_37849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1213 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 652 RRSQWYHIRAFVLAYTNIALRRMLRRFP 679 >SB_29698| Best HMM Match : DUF1610 (HMM E-Value=4.6) Length = 739 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + LRR+ RRIP Sbjct: 323 RRSQWYHIRAFVLEYTNIALRRMSRRIP 350 >SB_27946| Best HMM Match : DEAD (HMM E-Value=0.42) Length = 751 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 186 RRSQWYHIRAFVLAYTNIALRRMLRRFP 213 >SB_23543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 869 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 319 RRSQWYHIRAFVLAYTNIALRRMLRRFP 346 >SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) Length = 870 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 688 RRSQWYHIRAFVLAYTNIALRRMLRRFP 715 >SB_20530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++R+IP Sbjct: 195 RRSQWYHIRAFVLAYTNIALRRMLRQIP 222 >SB_10218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 744 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 678 RRSQWYHIRAFVLAYTNIALRRMLRRFP 705 >SB_9872| Best HMM Match : ResIII (HMM E-Value=0.36) Length = 624 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 91 RRSQWYHIRAFVLAYTNIALRRMLRRFP 118 >SB_9659| Best HMM Match : ResIII (HMM E-Value=0.39) Length = 333 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 72 RRSQWYHIRAFVLAYTNIALRRMLRRFP 99 >SB_3753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 976 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 481 RRSQWYHIRAFVLAYTNIALRRMLRRFP 508 >SB_59747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1064 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 684 RRSQWYHIRAFVLAYTNIALRRMLRRFP 711 >SB_53226| Best HMM Match : ResIII (HMM E-Value=0.45) Length = 880 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 569 RRSQWYHIRAFVLAYTNIALRRMLRRFP 596 >SB_53060| Best HMM Match : ResIII (HMM E-Value=0.14) Length = 1248 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 708 RRSQWYHIRAFVLAYTNIALRRMLRRFP 735 >SB_51306| Best HMM Match : Peptidase_C27 (HMM E-Value=0.78) Length = 645 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 538 RRSQWYHIRAFVLAYTNIALRRMLRRFP 565 >SB_48412| Best HMM Match : ResIII (HMM E-Value=0.19) Length = 1390 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 825 RRSQWYHIRAFVLAYTNIALRRMLRRFP 852 >SB_48295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1269 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 704 RRSQWYHIRAFVLAYTNIALRRMLRRFP 731 >SB_46041| Best HMM Match : LIM (HMM E-Value=1.5) Length = 1236 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 684 RRSQWYHIRAFVLAYTNIALRRMLRRFP 711 >SB_44056| Best HMM Match : Fumerase_C (HMM E-Value=4.5) Length = 438 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 405 RRSQWYHIRAFVLAYTNIALRRMLRRFP 432 >SB_40200| Best HMM Match : Ribosomal_L27 (HMM E-Value=2.6) Length = 333 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 254 RRSQWYHIRAFVLAYTNIALRRMLRRFP 281 >SB_34841| Best HMM Match : ResIII (HMM E-Value=1.6) Length = 949 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 624 RRSQWYHIRAFVLAYTNIALRRMLRRFP 651 >SB_31859| Best HMM Match : DUF1131 (HMM E-Value=4.3) Length = 455 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 335 RRSQWYHIRAFVLAYTNIALRRMLRRFP 362 >SB_24707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 921 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 502 RRSQWYHIRAFVLAYTNIALRRMLRRFP 529 >SB_21729| Best HMM Match : Ribosomal_L27 (HMM E-Value=5.7) Length = 268 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 189 RRSQWYHIRAFVLAYTNIALRRMLRRFP 216 >SB_20407| Best HMM Match : ResIII (HMM E-Value=0.36) Length = 1175 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + L+R++RRIP Sbjct: 618 RRSQWYHIRAFVLAYTNIALQRMLRRIP 645 >SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) Length = 1179 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 626 RRSQWYHIRAFVLAYTNIALRRMLRRFP 653 >SB_7073| Best HMM Match : ResIII (HMM E-Value=0.083) Length = 1105 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 621 RRSQWYHIRAFVLAYTNIALRRMLRRFP 648 >SB_5505| Best HMM Match : ResIII (HMM E-Value=0.55) Length = 1346 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 780 RRSQWYHIRAFVLAYTNIALRRMLRRFP 807 >SB_1076| Best HMM Match : Phage_tail_S (HMM E-Value=2.7) Length = 834 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 R +W H V + + LRRL+RRIP Sbjct: 428 RSSQWYHIRAFVLAYTNIALRRLLRRIP 455 >SB_204| Best HMM Match : ResIII (HMM E-Value=1.2) Length = 244 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 3 RRLRWLHPERMVESRIQLGLRRLVRRIP 86 RR +W H V + + LRR++RR P Sbjct: 41 RRSQWYHIRAFVLAYTNIALRRMLRRFP 68 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,484,860 Number of Sequences: 59808 Number of extensions: 193806 Number of successful extensions: 794 Number of sequences better than 10.0: 154 Number of HSP's better than 10.0 without gapping: 722 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 793 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1312894764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -