BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30657 (690 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 28 0.083 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 27 0.19 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 2.4 AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-mon... 22 4.1 AY052623-1|AAL15471.1| 101|Tribolium castaneum kynurenine 3-mon... 22 4.1 AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 22 4.1 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 22 4.1 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 22 4.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 5.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 5.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 5.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 5.4 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 9.5 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 9.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 9.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 9.5 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 27.9 bits (59), Expect = 0.083 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = -2 Query: 569 QQADVTKIDDAHVSISMADSVLDESEPFSFTETQSLEYTTSTTQDIISPRDE 414 QQ + ID+ S+ + +E+ P + T STTQ ++ P+ E Sbjct: 1771 QQETIPPIDEEPPSVEAVEEEREEAPPSVHSSTVVPPPQHSTTQSLVDPKSE 1822 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 26.6 bits (56), Expect = 0.19 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 168 LFTFYILYNTGSFDFI--RLFIVC-FNFVC---VFTFHILYNTRSFDFIRFFIACFNFVF 329 +FT ++L+ + F+ F++C + F C +FT H+L+ + F FI + Sbjct: 122 IFTVHLLFLLCIYYFVVPLFFLLCIYYFYCAFIIFTVHLLFLLCIYHFFCAFIIFTMHLL 181 Query: 330 FSC 338 F C Sbjct: 182 FCC 184 Score = 26.2 bits (55), Expect = 0.25 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 2/60 (3%) Frame = +3 Query: 168 LFTFYILYNTGS--FDFIRLFIVCFNFVCVFTFHILYNTRSFDFIRFFIACFNFVFFSCL 341 +FT ++L+ F+ LF++C ++ FT H+L+ + F FI + F C+ Sbjct: 175 IFTMHLLFCCAFIFFNMHLLFLLCLDY---FTLHLLFLPCIYYFYSAFIIFTIHLLFYCV 231 Score = 22.2 bits (45), Expect = 4.1 Identities = 12/61 (19%), Positives = 25/61 (40%) Frame = +3 Query: 153 FRFNSLFTFYILYNTGSFDFIRLFIVCFNFVCVFTFHILYNTRSFDFIRFFIACFNFVFF 332 F + LF + Y T F+ ++ +FT H+L+ + + + F+ F Sbjct: 189 FNMHLLFLLCLDYFTLHLLFLPCIYYFYSAFIIFTIHLLFYCVLIILLCIYYFYYAFILF 248 Query: 333 S 335 + Sbjct: 249 T 249 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.0 bits (47), Expect = 2.4 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -2 Query: 332 EKDEVKTGDKESDKIETSGIVENVKREDTYEVKTDDKKSNK 210 +KD+ K D D+ E + + K++ E T+D++ NK Sbjct: 241 DKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTEDEELNK 281 >AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 212 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = -2 Query: 197 GIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKP 75 G E++ ++ T DAVP+ D + N+ +KP Sbjct: 8 GKFESLRNAAELKDFYYKTFPDAVPLIGEDLLVNDFFKVKP 48 >AY052623-1|AAL15471.1| 101|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 101 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = -2 Query: 197 GIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKP 75 G E++ ++ T DAVP+ D + N+ +KP Sbjct: 23 GKFESLRNAAELKDFYYKTFPDAVPLIGEDLLVNDFFKVKP 63 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = -2 Query: 197 GIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKP 75 G E++ ++ T DAVP+ D + N+ +KP Sbjct: 241 GKFESLRNAAELKDFYYKTFPDAVPLIGEDLLVNDFFKVKP 281 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = -2 Query: 197 GIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKP 75 G E++ ++ T DAVP+ D + N+ +KP Sbjct: 241 GKFESLRNAAELKDFYYKTFPDAVPLIGEDLLVNDFFKVKP 281 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = -2 Query: 197 GIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKP 75 G E++ ++ T DAVP+ D + N+ +KP Sbjct: 241 GKFESLRNAAELKDFYYKTFPDAVPLIGEDLLVNDFFKVKP 281 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +3 Query: 609 RFRCRKRWSNVVWNEFII 662 + R RKRWS V++ +++ Sbjct: 691 KIRHRKRWSQVMYMYYLL 708 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +3 Query: 609 RFRCRKRWSNVVWNEFII 662 + R RKRWS V++ +++ Sbjct: 691 KIRHRKRWSQVMYMYYLL 708 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +3 Query: 609 RFRCRKRWSNVVWNEFII 662 + R RKRWS V++ +++ Sbjct: 691 KIRHRKRWSQVMYMYYLL 708 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +3 Query: 609 RFRCRKRWSNVVWNEFII 662 + R RKRWS V++ +++ Sbjct: 691 KIRHRKRWSQVMYMYYLL 708 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.0 bits (42), Expect = 9.5 Identities = 6/18 (33%), Positives = 12/18 (66%) Frame = +3 Query: 609 RFRCRKRWSNVVWNEFII 662 + R +KRWS ++ F++ Sbjct: 116 KIRAKKRWSQCMYMYFLL 133 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 9.5 Identities = 6/18 (33%), Positives = 12/18 (66%) Frame = +3 Query: 609 RFRCRKRWSNVVWNEFII 662 + R +KRWS ++ F++ Sbjct: 430 KIRAKKRWSQCMYMYFLL 447 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 9.5 Identities = 6/18 (33%), Positives = 12/18 (66%) Frame = +3 Query: 609 RFRCRKRWSNVVWNEFII 662 + R +KRWS ++ F++ Sbjct: 663 KIRAKKRWSQCMYMYFLL 680 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 9.5 Identities = 6/18 (33%), Positives = 12/18 (66%) Frame = +3 Query: 609 RFRCRKRWSNVVWNEFII 662 + R +KRWS ++ F++ Sbjct: 663 KIRAKKRWSQCMYMYFLL 680 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,495 Number of Sequences: 336 Number of extensions: 3059 Number of successful extensions: 19 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -