BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30656 (519 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0428 - 3127098-3129254 31 0.73 03_05_0845 - 28155065-28155374,28156201-28156342,28156375-281565... 30 1.3 05_03_0353 - 12856385-12857705,12858007-12858959 28 5.2 03_05_0736 - 27254502-27255497 28 5.2 02_02_0453 + 10420585-10421661,10422015-10422146,10422232-104224... 28 5.2 01_05_0679 + 24230740-24230929,24231330-24231461,24231710-242319... 27 6.8 09_06_0243 - 21813223-21813456,21814266-21814367,21814501-218147... 27 9.0 05_04_0345 + 20451497-20451740,20452078-20452159,20452837-204528... 27 9.0 >02_01_0428 - 3127098-3129254 Length = 718 Score = 30.7 bits (66), Expect = 0.73 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = +2 Query: 107 ASKVVTPTYVASKVVPPSGAGYDYKYGIIRYDNDVAPEGY 226 A ++ PTY++SK P+ + Y+Y I+R + +VA G+ Sbjct: 523 ARVLILPTYMSSKKDLPALKDWKYEYRILRAEVNVARNGF 562 >03_05_0845 - 28155065-28155374,28156201-28156342,28156375-28156505, 28156591-28156784,28156859-28156969,28157234-28157399, 28157501-28157668,28157766-28158787 Length = 747 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +2 Query: 296 ENEGIKVKGFYEYVGPDGVTYRVDYTAD 379 E G +++G +VGPDG TYR + AD Sbjct: 90 EFRGGRIEGQGVFVGPDGATYRGAWAAD 117 >05_03_0353 - 12856385-12857705,12858007-12858959 Length = 757 Score = 27.9 bits (59), Expect = 5.2 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -3 Query: 97 GCDWHGNGRLHDGQGNNAGSLVSITKVFAEVL 2 GC+W G GQ A S VS T E+L Sbjct: 172 GCEWSDPGFFLRGQEEEASSSVSTTTAMEEIL 203 >03_05_0736 - 27254502-27255497 Length = 331 Score = 27.9 bits (59), Expect = 5.2 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Frame = +3 Query: 222 ATTTCTRPR--TRFSLKKPARSRTLAPKTKASRS 317 ATTT + P+ T+F+L + ARS T P +K+ S Sbjct: 14 ATTTLSSPQLCTQFALDRVARSTTTIPLSKSKSS 47 >02_02_0453 + 10420585-10421661,10422015-10422146,10422232-10422456, 10422555-10422680,10422777-10422839,10423214-10423296, 10424078-10424309,10424421-10424489,10424532-10424731, 10424819-10424894,10425015-10425081,10425194-10425471, 10425600-10425787,10426235-10426391,10426496-10426741 Length = 1072 Score = 27.9 bits (59), Expect = 5.2 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -3 Query: 133 VCGCDHLAGNVCGCDWHGNGRLHDGQGNNAG 41 VC C H G++C CD G+ D + G Sbjct: 8 VCSCPHYKGSLCFCDCGCFGQTPDSPRESRG 38 >01_05_0679 + 24230740-24230929,24231330-24231461,24231710-24231977, 24232170-24232388,24233538-24233673,24233899-24234147, 24234783-24235100 Length = 503 Score = 27.5 bits (58), Expect = 6.8 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -2 Query: 158 WVGPPCWQRMWV*P 117 W CWQRMWV P Sbjct: 14 WPTASCWQRMWVHP 27 >09_06_0243 - 21813223-21813456,21814266-21814367,21814501-21814701, 21815591-21815716,21815791-21816072,21816218-21816388, 21816838-21816999,21817404-21817467,21818136-21818503 Length = 569 Score = 27.1 bits (57), Expect = 9.0 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = +2 Query: 233 LYETENKILAEEAGKVENVGTENEGIKVKGFYEYVGPDGVTYRVDYTADENGFVA 397 L + E + A +A + E + + G GPDG T+R E G VA Sbjct: 513 LQKIEERTSARKAKQYEKSDEIRKELAAVGIALMDGPDGTTWRPSVPLSEQGVVA 567 >05_04_0345 + 20451497-20451740,20452078-20452159,20452837-20452882, 20453669-20454352 Length = 351 Score = 27.1 bits (57), Expect = 9.0 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 Query: 99 HTLPARWSHPHTLP 140 H LP +W+HP T+P Sbjct: 145 HQLPQKWAHPITMP 158 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,529,687 Number of Sequences: 37544 Number of extensions: 222019 Number of successful extensions: 652 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 632 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1130733700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -