BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30652 (313 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 184 2e-47 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 183 2e-47 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 182 4e-47 SB_56| Best HMM Match : Actin (HMM E-Value=0) 182 4e-47 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 182 5e-47 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 180 2e-46 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 162 5e-41 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 4e-21 SB_54| Best HMM Match : Actin (HMM E-Value=0) 88 2e-18 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 60 4e-10 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 44 2e-05 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) 38 0.001 SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) 36 0.005 SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.062 SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) 29 1.0 SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_47898| Best HMM Match : Extensin_2 (HMM E-Value=0.88) 27 2.3 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 27 4.1 SB_40695| Best HMM Match : ABC_tran (HMM E-Value=7.79963e-42) 26 5.4 SB_52826| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.4 SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) 26 7.2 SB_46935| Best HMM Match : Merozoite_SPAM (HMM E-Value=1.8) 26 7.2 SB_18870| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_9716| Best HMM Match : HMG_box (HMM E-Value=0.0041) 25 9.5 SB_28847| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_23835| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) 25 9.5 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 184 bits (447), Expect = 2e-47 Identities = 84/91 (92%), Positives = 88/91 (96%) Frame = -3 Query: 275 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 96 LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMES GIHET YNSIMKCDVDIRKDLYA Sbjct: 199 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 258 Query: 95 NTVMSGGTTMYPGIADRMQKEITALAPSTIK 3 NTV+SGGTTMYPGIADRMQKEI+ALAP T+K Sbjct: 259 NTVLSGGTTMYPGIADRMQKEISALAPPTMK 289 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 183 bits (446), Expect = 2e-47 Identities = 84/91 (92%), Positives = 88/91 (96%) Frame = -3 Query: 275 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 96 +EKSYELPDGQVITIGNERFRCPEAL QPSFLGMES GIHET YNSIMKCDVDIRKDLYA Sbjct: 210 IEKSYELPDGQVITIGNERFRCPEALLQPSFLGMESSGIHETTYNSIMKCDVDIRKDLYA 269 Query: 95 NTVMSGGTTMYPGIADRMQKEITALAPSTIK 3 NTVMSGGTTMYPG+ADRMQKEI+ALAPST+K Sbjct: 270 NTVMSGGTTMYPGLADRMQKEISALAPSTMK 300 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 182 bits (444), Expect = 4e-47 Identities = 83/91 (91%), Positives = 88/91 (96%) Frame = -3 Query: 275 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 96 LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMES GIHET YNSIMKCDVDIRKDLYA Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 296 Query: 95 NTVMSGGTTMYPGIADRMQKEITALAPSTIK 3 NTV+SGG+TMYPGIADRMQKEIT+LAP T+K Sbjct: 297 NTVLSGGSTMYPGIADRMQKEITSLAPPTMK 327 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 182 bits (444), Expect = 4e-47 Identities = 83/91 (91%), Positives = 88/91 (96%) Frame = -3 Query: 275 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 96 LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMES GIHET YNSIMKCDVDIRKDLYA Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 295 Query: 95 NTVMSGGTTMYPGIADRMQKEITALAPSTIK 3 NTV+SGG+TMYPGIADRMQKEIT+LAP T+K Sbjct: 296 NTVLSGGSTMYPGIADRMQKEITSLAPPTMK 326 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 182 bits (443), Expect = 5e-47 Identities = 83/91 (91%), Positives = 88/91 (96%) Frame = -3 Query: 275 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 96 LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMES GIHET YNSIMKCDVDIRKDLYA Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 296 Query: 95 NTVMSGGTTMYPGIADRMQKEITALAPSTIK 3 NTV+SGG+TMYPGIADRMQKEI+ALAP T+K Sbjct: 297 NTVLSGGSTMYPGIADRMQKEISALAPPTMK 327 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 180 bits (439), Expect = 2e-46 Identities = 82/91 (90%), Positives = 88/91 (96%) Frame = -3 Query: 275 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 96 LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMES GIHET YNSIMKCDVDIRKDLYA Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 295 Query: 95 NTVMSGGTTMYPGIADRMQKEITALAPSTIK 3 NTV+SGG+TM+PGIADRMQKEI+ALAP T+K Sbjct: 296 NTVLSGGSTMFPGIADRMQKEISALAPPTMK 326 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 162 bits (394), Expect = 5e-41 Identities = 72/93 (77%), Positives = 85/93 (91%) Frame = -3 Query: 281 PPLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDL 102 P LEK+YELPDGQVI+IGNERFRCPEA+FQP+FLGME+ GIHE +YN IMKCDVDIRKDL Sbjct: 8 PILEKTYELPDGQVISIGNERFRCPEAMFQPAFLGMEAPGIHEAIYNCIMKCDVDIRKDL 67 Query: 101 YANTVMSGGTTMYPGIADRMQKEITALAPSTIK 3 Y+N V+SGG+TM+PGIADRMQKEI LA +++K Sbjct: 68 YSNCVLSGGSTMFPGIADRMQKEIAMLANASMK 100 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 96.3 bits (229), Expect = 4e-21 Identities = 39/85 (45%), Positives = 58/85 (68%) Frame = -3 Query: 275 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYA 96 L + Y LPDG+V+ + ERF PEALFQP + +E G+ E ++N+I D+D R + Y Sbjct: 240 LVEQYTLPDGRVVKLSGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYK 299 Query: 95 NTVMSGGTTMYPGIADRMQKEITAL 21 + V+SGG+TMYPG+ R+++EI L Sbjct: 300 HIVLSGGSTMYPGLPSRLEREIKQL 324 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 87.8 bits (208), Expect = 2e-18 Identities = 40/73 (54%), Positives = 50/73 (68%) Frame = -3 Query: 296 ELGTGPPLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVD 117 E T E Y LPDGQ I IG+ERFR E LFQPS LG + GIHE+++ SI KCD+D Sbjct: 2274 EAETSDDCEAPYMLPDGQSIRIGSERFRAAEPLFQPSLLGRDIDGIHESIFKSIKKCDID 2333 Query: 116 IRKDLYANTVMSG 78 +R +L+ N V+SG Sbjct: 2334 LRAELFHNIVLSG 2346 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 60.1 bits (139), Expect = 4e-10 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 1/80 (1%) Frame = -3 Query: 239 ITIGNERFRCPEALFQPSFLGME-SCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMY 63 + + ERF PE F P F + + + E V N I C +D+R+ LY N V+SGG+TM+ Sbjct: 196 VDVAYERFLGPEIFFHPEFSNPDFTTPLSEVVDNVIQNCPIDVRRPLYKNIVLSGGSTMF 255 Query: 62 PGIADRMQKEITALAPSTIK 3 R+Q++I + +K Sbjct: 256 RDFGRRLQRDIKRTVDARLK 275 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 44.4 bits (100), Expect = 2e-05 Identities = 16/59 (27%), Positives = 35/59 (59%) Frame = -3 Query: 179 GMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIK 3 G + G+ + V S+ D+DIR L+ + +++GG T+ G +R+ +E+ + P +++ Sbjct: 146 GSTAMGVTQVVTTSVGMTDIDIRAGLFNSVIVTGGNTLLQGFVERLNRELVSKTPPSMR 204 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 41.9 bits (94), Expect = 1e-04 Identities = 20/54 (37%), Positives = 29/54 (53%) Frame = -3 Query: 173 ESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPS 12 E + + +S++ C +D RK L N V+ GGT M PG R+ +EI L S Sbjct: 54 EEKSLATALLDSLLLCPIDTRKTLAENIVLIGGTAMTPGFKHRLMQEIYLLLQS 107 >SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) Length = 367 Score = 38.3 bits (85), Expect = 0.001 Identities = 16/35 (45%), Positives = 26/35 (74%) Frame = -3 Query: 161 IHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPG 57 I E + +I K D+D+R+ LY+N V+SGG+T++ G Sbjct: 257 IIEVLAFAIQKSDLDLRRVLYSNIVLSGGSTLFKG 291 >SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) Length = 921 Score = 36.3 bits (80), Expect = 0.005 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = -3 Query: 287 TGPPLEKSYELPDGQVITIGNERFRCPEALFQPSFL 180 T L K Y LPDGQ+I+IG E E LF+P L Sbjct: 863 TNEGLTKFYTLPDGQMISIGYECISSMEPLFRPDLL 898 >SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 32.7 bits (71), Expect = 0.062 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 Query: 209 PEALFQPSFLGMESCGIHETV 147 PE +FQPS LG+E GI ET+ Sbjct: 3 PEIIFQPSMLGLEQAGITETM 23 >SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) Length = 1079 Score = 28.7 bits (61), Expect = 1.0 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -2 Query: 165 RHPRDRVQLHHEVRRRHP*GPVRQH--RHVRWYHHVPRYRRQDAE 37 R P+DR + HH RRRH R+H H R H ++ DA+ Sbjct: 830 RPPQDRHRRHHH-RRRHHNNKHRKHSREHSRRRHQRKHHKGNDAQ 873 Score = 27.9 bits (59), Expect = 1.8 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = -2 Query: 189 FLPGYGIVRHP-RDRVQLHHEV-RRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRA 16 F+ G G++ H + Q+ E R + G +HRH R +HH ++ R+ + + A Sbjct: 894 FVNGGGMMEHELQSDSQISQETGARENDPGKKHKHRHRRHHHHRRQHNRKIKKHRRKHSA 953 Query: 15 LDHQ 4 H+ Sbjct: 954 RKHE 957 >SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 1.3 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 95 NTVMSGGTTMYPGIADRMQKEITALAP 15 N ++GG TMY R+++E+ A+ P Sbjct: 132 NVFVTGGNTMYNNFMARLERELLAIRP 158 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 28.3 bits (60), Expect = 1.3 Identities = 18/69 (26%), Positives = 27/69 (39%) Frame = -2 Query: 210 SRGSLPAFLPGYGIVRHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGD 31 +R ++P LPG H R R HH ++H ++ HH Q + Sbjct: 930 ARPNMPGTLPGNYPESHKRHRHSHHHH------------YQHYQYNHHHDHQSHQHHDSH 977 Query: 30 HRPRALDHQ 4 H LDH+ Sbjct: 978 HHREVLDHK 986 >SB_47898| Best HMM Match : Extensin_2 (HMM E-Value=0.88) Length = 490 Score = 27.5 bits (58), Expect = 2.3 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = -2 Query: 135 HEVRRRHP*GPVRQHRHVRWYHHVP----RYRRQDAE 37 H R+H P R HR+ R + +P RY R+DA+ Sbjct: 307 HRYTRKHAKIPTRIHRYTRKHAKIPTRIHRYTRKDAK 343 Score = 27.1 bits (57), Expect = 3.1 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 5/61 (8%) Frame = -2 Query: 204 GSLPAFLP-GYGIVRHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVP----RYRRQDA 40 G++ +LP GI + + + H R+H P R HR+ R + +P RY R+ A Sbjct: 185 GNMQRYLPESIGIPGNMQRYLTRIHRYTRKHAKIPTRIHRYTRKHAKIPTRIHRYTRKHA 244 Query: 39 E 37 + Sbjct: 245 K 245 Score = 25.4 bits (53), Expect = 9.5 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Frame = -2 Query: 165 RHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVP----RYRRQDAE 37 +H + Q+H R+ H P R HR+ R + +P RY R+ A+ Sbjct: 438 KHAKIPTQIHRYTRK-HAKIPTRIHRYTRKHAKIPTQIHRYTRKHAK 483 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 27.5 bits (58), Expect = 2.3 Identities = 19/50 (38%), Positives = 23/50 (46%) Frame = -2 Query: 159 PRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALD 10 PRDR + E RRR P R+ R + Y PR RR+ R R D Sbjct: 854 PRDRRRRSPEHRRRREASPPRRDR--KRYDSPPRRRRRSPSPPPRRRRRD 901 >SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 27.1 bits (57), Expect = 3.1 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = -2 Query: 177 YGIVRHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDH 28 Y +++PR R HH +H + H H +HH + Q H Sbjct: 247 YHKLKNPRHRYHHHHHHHHQH--NHHQHHHHHHHHHHNHHHHHQQHHHHH 294 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 26.6 bits (56), Expect = 4.1 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -2 Query: 138 HHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQ 46 HH R RH +HRH +HH Y R+ Sbjct: 324 HHHQRHRHR----HRHRHRHHHHHHHEYNRR 350 Score = 25.4 bits (53), Expect = 9.5 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -2 Query: 162 HPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHH 67 H R HH +RH +HRH +HH Sbjct: 314 HHRHHHHHHHHHHQRHRHRHRHRHRHHHHHHH 345 >SB_40695| Best HMM Match : ABC_tran (HMM E-Value=7.79963e-42) Length = 355 Score = 26.2 bits (55), Expect = 5.4 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 6/41 (14%) Frame = +3 Query: 105 VLTDVDV--ALHDG----VVHGLVDAARFHTQEGRLEESLG 209 + TD ++ ALHD +V GLV ++H QEG S+G Sbjct: 218 IYTDDEIWSALHDAKVGPLVSGLVGKLKYHIQEGGANFSVG 258 >SB_52826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2126 Score = 26.2 bits (55), Expect = 5.4 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = -2 Query: 234 HR*REVPLSRGSLPAFLPGYGIVRHPRDRVQLHHEVRRRHP*GP 103 HR P++ LPA + PR R + + R RHP P Sbjct: 859 HRINRSPVADDYLPALRHRSSVSPDPRGRPPISPDYRGRHPISP 902 >SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) Length = 193 Score = 25.8 bits (54), Expect = 7.2 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 138 HHEVRRRHP*GPVRQHRHVRWYHH 67 H + R+H R HRH + HH Sbjct: 89 HRHIHRQHHHQHYRHHRHQHYRHH 112 >SB_46935| Best HMM Match : Merozoite_SPAM (HMM E-Value=1.8) Length = 625 Score = 25.8 bits (54), Expect = 7.2 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = -2 Query: 171 IVRHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRR 49 IV P R + +E+R P G R+H H + P+ R+ Sbjct: 516 IVVDPTRRHSIPNEIRPLEPRGECRRHTHHHKHKVAPKKRK 556 >SB_18870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1352 Score = 25.4 bits (53), Expect = 9.5 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -2 Query: 177 YGIVRHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVP 61 Y I+RH RD V L H GP+ + R+ H P Sbjct: 588 YYILRHVRDVVGLDSTPLVMHADGPLPPNTLCRYAHRTP 626 >SB_9716| Best HMM Match : HMG_box (HMM E-Value=0.0041) Length = 169 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 132 EVRRRHP*GPVRQHRHVRWYHHVPRYRRQ 46 E+ + HP QH H +HH RYRR+ Sbjct: 48 EITQAHPGKDNSQHHH--HHHHRHRYRRR 74 >SB_28847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 25.4 bits (53), Expect = 9.5 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 Query: 170 IPYPGRKAGREP 205 IP+PG KAG EP Sbjct: 188 IPFPGSKAGHEP 199 >SB_23835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 596 Score = 25.4 bits (53), Expect = 9.5 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = -2 Query: 180 GYGIVRHPRDRVQ-LHHEVRRRHP*GP-VRQHRHVRW 76 G G R+P R Q + +V +R P P R+HR +W Sbjct: 184 GMGPSRYPHPRSQRVREDVLQRRPRPPQTRRHRDKKW 220 >SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) Length = 634 Score = 25.4 bits (53), Expect = 9.5 Identities = 15/61 (24%), Positives = 27/61 (44%) Frame = +1 Query: 58 PGYMVVPPDMTVLAYRSLRMSTSHFMMELYTVSWMPHDSIPRKEGWKRASGQRNLSLPMV 237 P Y + T+ + S ST+ + L +W PH + E +R S R+ L ++ Sbjct: 116 PWYNQTLGNDTMTSNMSFANSTNPYGDGLIYNNWTPHSFLTHFENLRRKSSDRHSLLKLI 175 Query: 238 I 240 + Sbjct: 176 L 176 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,892,372 Number of Sequences: 59808 Number of extensions: 204215 Number of successful extensions: 760 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 387973711 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -