BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30651 (736 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1236 + 25454371-25456801,25456891-25457177,25457258-254574... 33 0.18 08_01_0186 - 1561695-1561958,1562041-1562183,1562260-1562326,156... 33 0.24 05_07_0329 - 29308867-29308932,29309040-29309159,29309245-293093... 32 0.41 03_05_0866 - 28370034-28371352,28371447-28371995,28372507-28373512 32 0.41 01_06_1656 + 38946922-38947542,38947640-38947739,38948045-389481... 32 0.41 01_05_0487 + 22641133-22642182,22642276-22642863,22642961-226430... 32 0.41 04_04_0258 + 23988409-23989580,23990450-23990851,23991138-23991204 31 0.72 05_06_0276 + 26878732-26879574,26879920-26880387,26880800-268810... 31 0.95 03_05_0994 + 29541109-29542527 29 3.8 01_06_1713 - 39359558-39359590,39360000-39360074,39360437-393606... 29 3.8 04_04_1098 + 30876785-30876835,30876846-30877171,30877396-308774... 29 5.1 04_04_0596 - 26497863-26497913,26498010-26498081,26499015-264990... 29 5.1 10_08_0425 - 17806117-17806401,17806862-17806984,17807076-178072... 28 6.7 05_04_0411 + 21057838-21058878,21059723-21059926,21060011-21060238 28 6.7 01_01_1220 + 9862195-9862281,9862427-9862646,9862764-9862916,986... 28 6.7 12_02_0842 - 23588826-23589198,23589548-23590203 28 8.8 12_02_0800 + 23299674-23299678,23299714-23299791,23299876-232999... 28 8.8 11_06_0017 - 19288171-19288437,19288770-19288989,19291630-19291754 28 8.8 10_08_0106 + 14842748-14843085,14843122-14843250,14844145-148442... 28 8.8 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 28 8.8 01_01_0128 - 1167904-1168749,1168790-1168863,1169419-1169491,117... 28 8.8 >08_02_1236 + 25454371-25456801,25456891-25457177,25457258-25457416, 25457561-25457740,25457823-25458017,25459059-25459157, 25459508-25460137,25460250-25460591 Length = 1440 Score = 33.5 bits (73), Expect = 0.18 Identities = 33/118 (27%), Positives = 55/118 (46%), Gaps = 5/118 (4%) Frame = -1 Query: 709 EKYDLEERQKRQDYDLKELKERQKQQLRHKALKKGLDPEALTGKHPPKIQVASKYERRV- 533 E L+E +KR D+KELK ++KQ + K + +H + Q K + V Sbjct: 970 ESISLKE-EKRLLQDIKELKAQKKQLSSNMGSKAEMGEAFEQKEHIHEQQKILKKDSDVL 1028 Query: 532 --DTRSYDDKKKLFEGDLEKLNKDFLEKVWQERAEQFGGRQKARLPKWF--GERPGKK 371 + +S +DK + + + +D L K+ +E RQKA +WF + PG+K Sbjct: 1029 LTNLKSLEDKTRFIKKAFDD-ERDALRKLTEEHQAAHEVRQKA-YDEWFELKKEPGRK 1084 >08_01_0186 - 1561695-1561958,1562041-1562183,1562260-1562326, 1562417-1562529,1562603-1562671,1563831-1563870, 1563965-1564035,1565872-1566027,1566104-1566152, 1566228-1567631 Length = 791 Score = 33.1 bits (72), Expect = 0.24 Identities = 19/64 (29%), Positives = 30/64 (46%) Frame = -3 Query: 731 VHRQTRDREIRSRREAKETGLRLKRAQRKTKAATEAQSSQEGSRPRSAHRQAPAQNSSSV 552 + R R+ R + EAK KRA+ A A++ ++ R R A R+A Q +V Sbjct: 650 LERLRREERARIQAEAKAAEDARKRAEAAAAAEAAAEAKRQREREREAARKALQQMEKTV 709 Query: 551 QVRE 540 + E Sbjct: 710 DINE 713 >05_07_0329 - 29308867-29308932,29309040-29309159,29309245-29309364, 29309566-29310123,29310199-29310258,29310839-29310904, 29310993-29311103,29311167-29311257,29311349-29311449, 29311534-29311641,29311737-29314205 Length = 1289 Score = 32.3 bits (70), Expect = 0.41 Identities = 17/41 (41%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = -1 Query: 694 EERQKRQDYDLK--ELKERQKQQLRHKALKKGLDPEALTGK 578 EER K+++ + K E K R+K++ + K LKK + + LTGK Sbjct: 455 EERLKKEEEERKAEEAKRRKKEREKEKLLKKKQEGKLLTGK 495 >03_05_0866 - 28370034-28371352,28371447-28371995,28372507-28373512 Length = 957 Score = 32.3 bits (70), Expect = 0.41 Identities = 20/41 (48%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = -1 Query: 733 ECIVKLETEKYDLEERQK--RQDYDLKELKERQKQQLRHKA 617 E +VK E EK DLE + R+ L E+KER+K RHKA Sbjct: 670 ELVVKREKEKQDLERELELYRRKVHLFEVKERRKMS-RHKA 709 >01_06_1656 + 38946922-38947542,38947640-38947739,38948045-38948189, 38948868-38948991,38949443-38949960,38950111-38950458, 38950557-38950638,38951309-38951707,38951790-38951927, 38952063-38952108,38952200-38952369 Length = 896 Score = 32.3 bits (70), Expect = 0.41 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 1/89 (1%) Frame = -1 Query: 694 EERQKRQDYDLKELKERQKQQLRHKALKKGLDPEAL-TGKHPPKIQVASKYERRVDTRSY 518 ++ QK Q KELK+++K++ R + +K EAL K K + K ++R Sbjct: 332 KDTQKAQKQVEKELKQKEKEEARMRKQQKKQQEEALREQKRREKEEAEMKKQQRKQEEEA 391 Query: 517 DDKKKLFEGDLEKLNKDFLEKVWQERAEQ 431 ++K E + + K +K QE AE+ Sbjct: 392 QKEQKRREKEEAETRKQ--QKKQQEEAEK 418 >01_05_0487 + 22641133-22642182,22642276-22642863,22642961-22643068, 22643582-22643692,22643784-22643849,22644858-22644917, 22644990-22645119,22645159-22645547,22645783-22645902, 22645957-22646022,22646190-22646255 Length = 917 Score = 32.3 bits (70), Expect = 0.41 Identities = 17/49 (34%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = -1 Query: 721 KLETEKYDLEERQKRQDYDL-KELKERQKQQLRHKALKKGLDPEALTGK 578 +L K + E Q+ +D + +E+K +QK++ + K +KK D + LTGK Sbjct: 195 ELRKRKAEEERLQREEDERMVEEMKMQQKERDKGKTMKKRQDGKTLTGK 243 >04_04_0258 + 23988409-23989580,23990450-23990851,23991138-23991204 Length = 546 Score = 31.5 bits (68), Expect = 0.72 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -3 Query: 701 RSRREA-KETGLRLKRAQRKTKAATEAQSSQEGSRPRSAHRQAPAQNSSSV 552 R R E E GL ++ + + + T +S + SRP SAH P S V Sbjct: 292 RPREEVLAEKGLDWRKMETEIEQKTSRPTSSQSSRPNSAHSSRPGSPGSQV 342 >05_06_0276 + 26878732-26879574,26879920-26880387,26880800-26881021, 26881153-26881278,26881309-26881573,26881719-26881936 Length = 713 Score = 31.1 bits (67), Expect = 0.95 Identities = 28/105 (26%), Positives = 47/105 (44%), Gaps = 4/105 (3%) Frame = -3 Query: 716 RDREIRSRREAKETGLRLKRAQRKTKAATEAQSSQEGSRPRSAHRQ-APAQNSSSVQ--- 549 R RSR A++ G +R +R A + + + + S+HR+ +P + + S + Sbjct: 13 RSGRSRSRSPARDRGSPPRRRERSPAARSRSPRRRSPVKSTSSHRERSPVRRNGSPRRSP 72 Query: 548 VREACRHTILRRQKETVRG*PRETEQGLPREGVAREGRTVRRQAK 414 VR R R KE VR P+++ P RE + Q+K Sbjct: 73 VRSIGRSPQRDRVKEQVRS-PKQSWSRSPSPARKRESWSPSPQSK 116 >03_05_0994 + 29541109-29542527 Length = 472 Score = 29.1 bits (62), Expect = 3.8 Identities = 18/71 (25%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Frame = -1 Query: 694 EERQKRQDYDLKELKERQKQQLRHKALKKGLDPEALTGKHPPK---IQVASKYERRVDTR 524 EE++K +D + +E +E + + + + PEA PP+ + A++ + VDT Sbjct: 223 EEQEKGKDEEQEEKEEEEVPVVTRRGRSRKAAPEAAVAPPPPRARSTRAAARRGKAVDT- 281 Query: 523 SYDDKKKLFEG 491 S D+++ G Sbjct: 282 SLDERESEMAG 292 >01_06_1713 - 39359558-39359590,39360000-39360074,39360437-39360662, 39360792-39360880,39360960-39361053,39361134-39361318, 39361415-39361582,39361682-39361822,39362327-39362545, 39362628-39362744,39363154-39363248,39363662-39363743, 39363864-39363926,39364157-39364216,39364312-39364476, 39364574-39364759,39364890-39365180,39365262-39365405, 39365492-39366172,39367045-39367362 Length = 1143 Score = 29.1 bits (62), Expect = 3.8 Identities = 27/101 (26%), Positives = 48/101 (47%), Gaps = 3/101 (2%) Frame = -1 Query: 727 IVKLETEKYDLEERQKRQDYDLKELKERQKQQLRHK--ALKKGLDPEALTGKHPPKIQVA 554 ++ L+ + +L+ + + + YDL + R +Q HK L K L+ E K K + A Sbjct: 699 LLPLQKKFTELKSQFELKSYDLSLFQNRVEQNEHHKLGELVKKLEQELQESKQELKAKQA 758 Query: 553 SKYERRVDTRSYDDKK-KLFEGDLEKLNKDFLEKVWQERAE 434 +YE+ V T S +K K + + E K K+ ++E Sbjct: 759 -QYEKSVSTVSELEKTIKTYGSEREGRLKALERKIKSLKSE 798 >04_04_1098 + 30876785-30876835,30876846-30877171,30877396-30877418, 30877687-30879392 Length = 701 Score = 28.7 bits (61), Expect = 5.1 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 1/74 (1%) Frame = -1 Query: 706 KYDLEERQKR-QDYDLKELKERQKQQLRHKALKKGLDPEALTGKHPPKIQVASKYERRVD 530 K+D ER+KR QD KEL E+QKQ+ K L + E K + K ++R + Sbjct: 628 KHDELERKKRSQDEKRKEL-EKQKQEEERKELDRQKQRE-----EERKAKELEKQKQREE 681 Query: 529 TRSYDDKKKLFEGD 488 R +K+K E D Sbjct: 682 ERKALEKQKQGERD 695 >04_04_0596 - 26497863-26497913,26498010-26498081,26499015-26499093, 26499440-26499553,26499822-26499871,26500353-26500398, 26501100-26501719 Length = 343 Score = 28.7 bits (61), Expect = 5.1 Identities = 23/94 (24%), Positives = 47/94 (50%), Gaps = 4/94 (4%) Frame = -1 Query: 709 EKYDLEERQKRQDYDLKELKERQKQQLRHKALKKGLDPEAL--TGKHPPKIQVASKYE-- 542 E+ + E R++R+D + ++ KE+++++ R K KK E GK KY Sbjct: 142 EREEEERRRRRKDKERRKRKEKERERERKKKEKKKRRKEEKKNLGKKAAVTNSWGKYGII 201 Query: 541 RRVDTRSYDDKKKLFEGDLEKLNKDFLEKVWQER 440 R VD + + + +++++N + L W+E+ Sbjct: 202 REVDMWNKRPEFTAWLSEVKQVNLEALSN-WEEK 234 >10_08_0425 - 17806117-17806401,17806862-17806984,17807076-17807222, 17807307-17807450,17808557-17808668,17808762-17808898, 17809016-17809156,17810921-17811004,17811275-17811742, 17811858-17811936,17812494-17812506,17813884-17814460, 17814502-17814774,17814899-17815045,17815354-17815413, 17816124-17816510 Length = 1058 Score = 28.3 bits (60), Expect = 6.7 Identities = 24/102 (23%), Positives = 46/102 (45%), Gaps = 9/102 (8%) Frame = -1 Query: 706 KYDLEERQKRQDYDLKELKERQKQQLRHKALKKGLDPEALTG---------KHPPKIQVA 554 K D + + K ++ ++++ KER++Q++ LK EA++ K P Sbjct: 870 KLDEQAKLKEREREMRKRKEREEQEMERVKLKIRRK-EAVSSYQALLVEIIKDPKASWTE 928 Query: 553 SKYERRVDTRSYDDKKKLFEGDLEKLNKDFLEKVWQERAEQF 428 SK D + L +GD EKL +D ++ +++ F Sbjct: 929 SKPRLEKDPQGRAVNPDLGKGDAEKLFRDHVKDLYERCVRDF 970 >05_04_0411 + 21057838-21058878,21059723-21059926,21060011-21060238 Length = 490 Score = 28.3 bits (60), Expect = 6.7 Identities = 18/75 (24%), Positives = 34/75 (45%) Frame = -3 Query: 668 RLKRAQRKTKAATEAQSSQEGSRPRSAHRQAPAQNSSSVQVREACRHTILRRQKETVRG* 489 R K +TKA+ EA Q+G R + R+ + + LR+++E R Sbjct: 417 RSKTEAARTKASQEAFREQQGLRQEALQRKKAEKKKLMEEAEAKLSAEALRKKEEKERA- 475 Query: 488 PRETEQGLPREGVAR 444 R+ ++ +P+ + R Sbjct: 476 -RQMKKSMPKVKMLR 489 >01_01_1220 + 9862195-9862281,9862427-9862646,9862764-9862916, 9863016-9863674,9863749-9863852,9863950-9864192, 9864262-9864376,9864696-9864909,9864995-9865511, 9866439-9866448,9867363-9867551,9867755-9868084, 9868639-9868872,9869303-9869743 Length = 1171 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 487 GHPRTVSFCRRRIVCRHASRTWTLLEFWAG 576 GH R VS R R + H +R+W L+ +G Sbjct: 103 GHERVVSVFRDRALELHTTRSWDFLDVQSG 132 >12_02_0842 - 23588826-23589198,23589548-23590203 Length = 342 Score = 27.9 bits (59), Expect = 8.8 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 4/51 (7%) Frame = -1 Query: 709 EKYDLEERQK----RQDYDLKELKERQKQQLRHKALKKGLDPEALTGKHPP 569 E+ + E R+K R+D + KE K ++ +H L K LD A + PP Sbjct: 277 ERVEAEYREKMAGLRRDAEAKEQKMAEQWAAKHARLAKFLDQVAACRRWPP 327 >12_02_0800 + 23299674-23299678,23299714-23299791,23299876-23299920, 23300052-23300415,23300493-23300574,23300793-23300873, 23300974-23302106,23302202-23302350,23302426-23302516, 23303628-23305940 Length = 1446 Score = 27.9 bits (59), Expect = 8.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 640 KQQLRHKALKKGLDPEALTGKHPP 569 K+ RH KK +D +T KHPP Sbjct: 882 KKSARHSRNKKKVDEAPVTSKHPP 905 >11_06_0017 - 19288171-19288437,19288770-19288989,19291630-19291754 Length = 203 Score = 27.9 bits (59), Expect = 8.8 Identities = 14/37 (37%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Frame = -1 Query: 715 ETEKYDLEERQKRQDYDLKELKERQKQQL-RHKALKK 608 E EK EER+K ++ +KE E+Q+++L R++ L++ Sbjct: 124 ELEKKLEEERKKAEEAQMKEAMEQQQKELERYQELER 160 >10_08_0106 + 14842748-14843085,14843122-14843250,14844145-14844211, 14847177-14847324,14847998-14848097,14848306-14848384, 14848527-14848687,14848829-14848908,14849319-14849475, 14849575-14849723,14849909-14850076,14850426-14850719, 14851002-14851046,14851213-14851462,14851707-14851835, 14852799-14853039,14853977-14854642 Length = 1066 Score = 27.9 bits (59), Expect = 8.8 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = -3 Query: 716 RDREIRSRREAKETGLRLKRAQRKTKAATEAQSSQEGSRPRSAHRQAPAQNS 561 RDRE SRREA+E+ + + ++SSQ R +P ++S Sbjct: 817 RDRERESRREARESSGANNDSTTSMRPKARSRSSQPADRSAPPPPASPDRHS 868 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 27.9 bits (59), Expect = 8.8 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 5/79 (6%) Frame = -1 Query: 733 ECIVKLETEKYD-----LEERQKRQDYDLKELKERQKQQLRHKALKKGLDPEALTGKHPP 569 E I KLE K D + +KRQ D L +++++ K +KG P + PP Sbjct: 71 EQIEKLEKMKADGALDKARKHKKRQLEDTYNLIVKKRKEYEEKMKEKGEQPIMFSHLGPP 130 Query: 568 KIQVASKYERRVDTRSYDD 512 K + A++ + R +D Sbjct: 131 KRRPAAEEDDRAKNPKPED 149 >01_01_0128 - 1167904-1168749,1168790-1168863,1169419-1169491, 1171148-1171398,1171442-1171687,1172220-1172415, 1172796-1172876,1172966-1173169,1173671-1173880, 1173953-1174174,1174437-1174480,1174974-1175052, 1175066-1175227,1175337-1175564,1175786-1175815, 1175905-1176273,1176356-1176571,1177202-1177683, 1177930-1177975 Length = 1352 Score = 27.9 bits (59), Expect = 8.8 Identities = 16/84 (19%), Positives = 45/84 (53%) Frame = -1 Query: 721 KLETEKYDLEERQKRQDYDLKELKERQKQQLRHKALKKGLDPEALTGKHPPKIQVASKYE 542 +L K +E+R++ + + E KE+++++ R LKK + E + + K++ + Sbjct: 604 RLLARKSIIEKRKEDLERQILE-KEKEEEKKRLSVLKKSAEDERIRLLNDVKLREQERIR 662 Query: 541 RRVDTRSYDDKKKLFEGDLEKLNK 470 R++ + + ++L + ++++ K Sbjct: 663 RQLVEKEKIEAEELLQKQIKEIAK 686 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,643,110 Number of Sequences: 37544 Number of extensions: 202394 Number of successful extensions: 1014 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 969 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1010 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1933531792 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -