BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30638 (785 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37752| Best HMM Match : MFS_1 (HMM E-Value=0.11) 30 1.8 SB_18704| Best HMM Match : MFS_1 (HMM E-Value=0.034) 29 3.2 SB_50002| Best HMM Match : Carn_acyltransf (HMM E-Value=6.5e-05) 28 9.9 SB_26360| Best HMM Match : PKD_channel (HMM E-Value=1.3e-30) 28 9.9 >SB_37752| Best HMM Match : MFS_1 (HMM E-Value=0.11) Length = 302 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = -3 Query: 663 INVIVHRWRKWRINFFIRISNQIQLFVTVTWTWTYEGPEYII*KKRANMLHHSL 502 I ++ + R WR F+ I L + + W W +E P ++I K R + H L Sbjct: 157 IILVAYFIRDWRT--FMLIGAAPGLAILLFWKWIFESPRWLITKGRLDEAHEIL 208 >SB_18704| Best HMM Match : MFS_1 (HMM E-Value=0.034) Length = 363 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = -3 Query: 663 INVIVHRWRKWRINFFIRISNQIQLFVTVTWTWTYEGPEYII*KKRANMLHHSL 502 I ++ + R WR F+ I L + + W W +E P +++ K R + H L Sbjct: 251 IILVAYFIRDWRT--FMLIGAAPGLAILLFWKWIFESPRWLLTKGRLDEAHEIL 302 >SB_50002| Best HMM Match : Carn_acyltransf (HMM E-Value=6.5e-05) Length = 326 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 166 YFICDLLCDNNIFYQLYFVTFIDYLRDKQTFNCVYPK 276 Y +CD+L DN+ Y + YLR Q N Y K Sbjct: 167 YSVCDILGDNDTRYATFSAITTLYLRYSQYKNTRYAK 203 >SB_26360| Best HMM Match : PKD_channel (HMM E-Value=1.3e-30) Length = 3015 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -3 Query: 651 VHRWRKWRINFFIRISNQIQLFVTVTWTWT 562 + W+ WR+ +++S ++L V T WT Sbjct: 279 IFEWKVWRVLDGLKLSENVELVVVGTAQWT 308 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,105,297 Number of Sequences: 59808 Number of extensions: 379061 Number of successful extensions: 608 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 608 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -